Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|118820
Gene name
Locationscaffold_9:1369056..1372707
Strand+
Gene length (bp)3651
Transcript length (bp)2901
Coding sequence length (bp)2901
Protein length (aa) 967

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03378 CAS_CSE1 CAS/CSE protein, C-terminus 6.7E-120 532 962
PF08506 Cse1 Cse1 1.5E-101 149 531
PF03810 IBN_N Importin-beta N-terminal domain 4.9E-15 20 90

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ERK4|XPO2_MOUSE Exportin-2 OS=Mus musculus GN=Cse1l PE=1 SV=1 14 963 0.0E+00
sp|P55060|XPO2_HUMAN Exportin-2 OS=Homo sapiens GN=CSE1L PE=1 SV=3 14 963 5.0E-180
sp|Q9PTU3|XPO2_PAGMA Exportin-2 OS=Pagrus major GN=cse1l PE=2 SV=1 14 963 1.0E-179
sp|A5D785|XPO2_BOVIN Exportin-2 OS=Bos taurus GN=CSE1L PE=2 SV=1 14 963 2.0E-179
sp|Q5R9J2|XPO2_PONAB Exportin-2 OS=Pongo abelii GN=CSE1L PE=2 SV=1 14 963 7.0E-178
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ERK4|XPO2_MOUSE Exportin-2 OS=Mus musculus GN=Cse1l PE=1 SV=1 14 963 0.0E+00
sp|P55060|XPO2_HUMAN Exportin-2 OS=Homo sapiens GN=CSE1L PE=1 SV=3 14 963 5.0E-180
sp|Q9PTU3|XPO2_PAGMA Exportin-2 OS=Pagrus major GN=cse1l PE=2 SV=1 14 963 1.0E-179
sp|A5D785|XPO2_BOVIN Exportin-2 OS=Bos taurus GN=CSE1L PE=2 SV=1 14 963 2.0E-179
sp|Q5R9J2|XPO2_PONAB Exportin-2 OS=Pongo abelii GN=CSE1L PE=2 SV=1 14 963 7.0E-178
sp|Q8AY73|XPO2_ORENI Exportin-2 OS=Oreochromis niloticus GN=cse1l PE=2 SV=1 14 963 4.0E-177
sp|Q7SZC2|XPO2_DANRE Exportin-2 OS=Danio rerio GN=cse1l PE=2 SV=1 11 963 5.0E-175
sp|O13671|CSE1_SCHPO Importin-alpha re-exporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap109 PE=3 SV=2 1 963 3.0E-174
sp|P33307|CSE1_YEAST Importin alpha re-exporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSE1 PE=1 SV=2 7 934 5.0E-173
sp|Q6GMY9|XPO2_XENLA Exportin-2 OS=Xenopus laevis GN=cse1l PE=2 SV=1 14 963 1.0E-171
sp|Q9XZU1|XPO2_DROME Exportin-2 OS=Drosophila melanogaster GN=Cas PE=2 SV=2 11 965 8.0E-158
sp|Q9ZPY7|XPO2_ARATH Exportin-2 OS=Arabidopsis thaliana GN=CAS PE=2 SV=1 14 954 5.0E-132
sp|Q54E36|XPO2_DICDI Exportin-2 OS=Dictyostelium discoideum GN=xpo2 PE=3 SV=1 1 944 3.0E-104
sp|F4J738|SAD2H_ARATH Importin beta-like SAD2 homolog OS=Arabidopsis thaliana GN=At3g59020 PE=1 SV=1 11 450 7.0E-19
sp|Q9EPL8|IPO7_MOUSE Importin-7 OS=Mus musculus GN=Ipo7 PE=1 SV=2 8 444 1.0E-14
sp|F4IRR2|SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana GN=SAD2 PE=1 SV=1 14 449 2.0E-14
sp|O95373|IPO7_HUMAN Importin-7 OS=Homo sapiens GN=IPO7 PE=1 SV=1 8 444 3.0E-14
sp|Q7TMY7|IPO8_MOUSE Importin-8 OS=Mus musculus GN=Ipo8 PE=1 SV=3 8 860 3.0E-14
sp|O15397|IPO8_HUMAN Importin-8 OS=Homo sapiens GN=IPO8 PE=1 SV=2 8 372 2.0E-12
sp|O94545|KA113_SCHPO Importin beta-like protein kap113 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap113 PE=3 SV=1 10 151 9.0E-11
sp|P46970|NMD5_YEAST Nonsense-mediated mRNA decay protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMD5 PE=1 SV=2 17 220 5.0E-10
sp|O59809|IMA3_SCHPO Probable importin c550.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.11 PE=3 SV=1 11 158 1.0E-09
sp|Q10297|IMB5_SCHPO Importin subunit beta-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap114 PE=3 SV=3 9 449 3.0E-08
sp|Q8K2V6|IPO11_MOUSE Importin-11 OS=Mus musculus GN=Ipo11 PE=1 SV=1 10 135 8.0E-08
sp|Q9UI26|IPO11_HUMAN Importin-11 OS=Homo sapiens GN=IPO11 PE=1 SV=1 10 135 2.0E-07
sp|Q02932|KA120_YEAST Importin beta-like protein KAP120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP120 PE=1 SV=1 12 132 7.0E-07
sp|Q55CX9|IPO7_DICDI Probable importin-7 homolog OS=Dictyostelium discoideum GN=DDB_G0269860 PE=3 SV=1 18 167 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0031267 small GTPase binding Yes
GO:0005515 protein binding Yes
GO:0015031 protein transport No
GO:0051179 localization No
GO:0071705 nitrogen compound transport No
GO:0051234 establishment of localization No
GO:0005488 binding No
GO:0070727 cellular macromolecule localization No
GO:0051020 GTPase binding No
GO:0019899 enzyme binding No
GO:0008150 biological_process No
GO:0045184 establishment of protein localization No
GO:0051641 cellular localization No
GO:0006810 transport No
GO:0008104 protein localization No
GO:0071702 organic substance transport No
GO:0046907 intracellular transport No
GO:0033036 macromolecule localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0051649 establishment of localization in cell No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|118820
MAELPALLVASLKPETRKQAEQNLNSISQQPGFLGALLQLVLNGSQERPARLAASIYLKNIAKSRWDEEVNPLPE
QDKAALRNQLVPAMLALSGPTDKTIRTQIAEAVSLIAELDFPSKWPDLLDQLVGSLSPTDYNVNVGVLETAHSIF
RPWRAQVRSDPLFTVINFVLSKFMVPFLGLFRQTSQLLLASAPSPNLPVVAQAMVLLIDVFYDLTCQDLPPAIED
NYNEFFGKDVGLFFRFLAWDPVELKSDPEDPAPSLPSQVKTGILEIAELFIKLYPDQLQKSPAVESFVQGVWNLI
GANKLPSVSDDHLVSQSLRFISTAIHSGYYKPLFSSRETIKSLVEGVVVSNIALREHEVEQFEDDPLEYIRMDLA
LSSTGLDSGSRRLAAADVLRSLVGGGYEVDTTEIVGSFISADLQAYRSNPAENWKAKDSAVFMMTAVASKGSTTK
HGVTSVNPLVDVVQFFSEHVFQDLQAQDGTVHPILQVDAIRFLYTFRNQLTKPQLLAVLPLLARHLTSGNYVTYT
YAAIAIDRILIIKQHNQLIFAQADIHDYAANLVDALLTKVEVGQTPEKLAENDHLMRCTMRVILTARQTLTPTYQ
QILARLVNILGIISKNPSNPHFDQFIFECISGLMRFVVAGSPNTLPVFEQALFNPFTFILQQDIDQFIPYSFQIL
AQMLELHDRDVPEEYRNLLPFLLMPAIWQQKGSIPGLVKLLKAFLARDSARMLATGQVASVLAVVQQRLIPSKVN
DSWGFELLNSVVQYVPPNDLQQYMKPVIMTLLTRMQTSKTTQYEYLFARFILYTIALNVEGLGPDYMIAVIEGIQ
PNLWSQVLTNFIIPQAPKVPHKDRKIAVVGVTRLLCQSKYMMQDAFIGAWPQAYQALIKLFSEPQHLSKKNDEDP
HAGITEIDYEEQTAGYQAAYSRLAASEMQEVDPVAYVSNPQQFFQEQVDLLEKAYGPQVQALMRPA*
Coding >AgabiH97|118820
ATGGCCGAACTCCCTGCCCTCCTCGTCGCTTCTCTCAAGCCAGAAACAAGAAAACAGGCTGAACAGAACTTGAAC
TCAATCTCCCAACAACCAGGTTTTCTTGGGGCTCTCCTGCAGCTTGTTCTCAATGGATCGCAGGAACGCCCAGCG
CGGCTCGCCGCAAGTATCTACCTCAAAAATATTGCCAAATCCCGGTGGGATGAAGAAGTGAATCCTCTCCCTGAA
CAAGACAAGGCAGCGCTACGGAATCAGCTAGTGCCCGCCATGCTCGCTTTGTCCGGTCCAACAGATAAAACAATC
CGTACCCAAATTGCGGAAGCAGTGTCTCTCATAGCAGAACTCGACTTCCCCAGCAAATGGCCTGATCTTCTTGAC
CAACTCGTCGGATCGCTATCGCCCACCGATTACAATGTCAATGTCGGAGTTTTGGAAACTGCTCATTCAATATTC
CGTCCATGGCGTGCTCAAGTACGATCTGACCCTCTCTTCACCGTCATCAATTTCGTGCTTTCCAAATTTATGGTC
CCCTTCCTCGGACTTTTTCGTCAAACCTCTCAACTTCTCCTCGCGTCCGCACCATCTCCAAATCTTCCTGTCGTT
GCACAAGCTATGGTTTTACTCATCGACGTATTCTACGACCTAACATGCCAAGACCTTCCGCCGGCGATCGAGGAC
AACTACAACGAATTCTTCGGAAAGGATGTGGGACTTTTCTTCAGGTTCCTTGCCTGGGACCCAGTCGAACTCAAG
TCAGATCCAGAGGATCCTGCCCCTTCACTCCCATCCCAAGTGAAGACAGGTATTCTCGAAATTGCAGAACTCTTC
ATTAAACTATATCCTGATCAACTACAAAAATCACCGGCCGTAGAATCTTTTGTTCAAGGTGTCTGGAACCTTATC
GGGGCAAACAAGTTGCCCAGTGTCTCCGACGATCATCTTGTATCTCAATCTTTAAGATTCATTTCGACGGCTATA
CATTCGGGTTACTACAAACCCTTATTTTCCTCCCGCGAAACTATAAAATCTCTAGTGGAAGGTGTTGTCGTTTCC
AACATAGCATTGCGTGAGCATGAGGTCGAACAATTTGAGGACGATCCTTTGGAGTATATTAGGATGGATCTCGCA
CTTTCTTCTACCGGTCTTGATAGTGGAAGTCGACGCCTTGCAGCGGCAGATGTCCTTCGGTCTCTTGTTGGCGGT
GGTTATGAAGTTGATACAACTGAAATCGTCGGTTCCTTCATCAGCGCCGACCTCCAAGCTTATCGGTCCAATCCA
GCGGAAAATTGGAAGGCTAAAGATAGTGCCGTATTCATGATGACCGCTGTTGCTAGTAAAGGATCGACGACAAAA
CATGGGGTTACTTCGGTCAACCCTCTCGTCGATGTTGTTCAATTCTTCTCCGAGCATGTCTTTCAGGATCTTCAG
GCGCAAGATGGTACCGTACATCCCATCTTACAAGTGGATGCAATCCGTTTTCTTTATACATTCCGCAATCAATTG
ACCAAGCCTCAACTCCTTGCCGTTCTTCCTCTGCTTGCCCGTCATCTGACTTCCGGGAATTATGTTACCTACACA
TATGCAGCCATTGCCATCGATCGTATACTCATCATCAAGCAACACAATCAACTAATTTTCGCGCAGGCCGACATA
CATGATTATGCAGCAAATCTAGTGGACGCGCTCTTGACCAAGGTGGAGGTTGGGCAAACACCTGAAAAACTCGCC
GAAAATGACCATCTTATGCGCTGTACCATGCGGGTTATTCTTACTGCTCGACAAACTCTAACACCAACATATCAA
CAAATACTTGCACGACTTGTCAATATTCTTGGTATTATTTCTAAGAACCCGAGCAATCCTCACTTCGATCAGTTC
ATTTTCGAGTGCATCTCTGGGCTCATGAGGTTTGTTGTAGCGGGATCGCCCAACACGCTACCCGTTTTTGAGCAG
GCCCTATTCAACCCTTTCACTTTCATACTTCAACAAGATATTGATCAATTTATCCCTTATTCATTCCAAATTCTT
GCTCAAATGCTAGAATTACATGACAGGGACGTTCCGGAAGAATATCGAAATTTGTTACCATTCCTCCTCATGCCT
GCTATATGGCAACAAAAGGGTAGTATCCCTGGTCTCGTCAAACTCTTAAAAGCTTTCCTGGCGCGGGATAGTGCC
CGGATGCTTGCTACCGGCCAAGTGGCTTCTGTACTCGCGGTCGTTCAGCAACGTTTGATACCCTCCAAGGTTAAT
GATTCTTGGGGATTTGAACTTTTGAATTCTGTCGTTCAATACGTCCCACCCAACGATCTGCAACAGTATATGAAA
CCTGTCATTATGACCCTGCTTACTCGAATGCAAACAAGTAAGACGACCCAATATGAGTATCTTTTTGCTCGTTTC
ATTCTATATACCATTGCTCTCAATGTCGAGGGACTTGGACCGGACTACATGATTGCTGTGATTGAAGGAATTCAG
CCCAATCTTTGGTCACAGGTCCTGACCAATTTCATCATTCCTCAAGCACCCAAAGTCCCGCACAAGGACAGGAAA
ATTGCCGTCGTTGGTGTCACTCGGTTATTGTGTCAGAGTAAATACATGATGCAAGATGCATTTATTGGCGCCTGG
CCTCAGGCTTATCAAGCGCTCATAAAGCTCTTCAGCGAGCCGCAACACCTTTCGAAAAAGAACGATGAAGACCCT
CATGCTGGCATTACGGAAATTGATTATGAAGAACAAACAGCAGGTTATCAAGCGGCATATTCGCGATTAGCTGCA
TCTGAGATGCAAGAAGTGGATCCAGTAGCATACGTTTCTAATCCCCAACAGTTCTTCCAAGAACAGGTTGATCTC
CTCGAGAAGGCATATGGACCTCAGGTTCAAGCCTTGATGCGTCCTGCATAG
Transcript >AgabiH97|118820
ATGGCCGAACTCCCTGCCCTCCTCGTCGCTTCTCTCAAGCCAGAAACAAGAAAACAGGCTGAACAGAACTTGAAC
TCAATCTCCCAACAACCAGGTTTTCTTGGGGCTCTCCTGCAGCTTGTTCTCAATGGATCGCAGGAACGCCCAGCG
CGGCTCGCCGCAAGTATCTACCTCAAAAATATTGCCAAATCCCGGTGGGATGAAGAAGTGAATCCTCTCCCTGAA
CAAGACAAGGCAGCGCTACGGAATCAGCTAGTGCCCGCCATGCTCGCTTTGTCCGGTCCAACAGATAAAACAATC
CGTACCCAAATTGCGGAAGCAGTGTCTCTCATAGCAGAACTCGACTTCCCCAGCAAATGGCCTGATCTTCTTGAC
CAACTCGTCGGATCGCTATCGCCCACCGATTACAATGTCAATGTCGGAGTTTTGGAAACTGCTCATTCAATATTC
CGTCCATGGCGTGCTCAAGTACGATCTGACCCTCTCTTCACCGTCATCAATTTCGTGCTTTCCAAATTTATGGTC
CCCTTCCTCGGACTTTTTCGTCAAACCTCTCAACTTCTCCTCGCGTCCGCACCATCTCCAAATCTTCCTGTCGTT
GCACAAGCTATGGTTTTACTCATCGACGTATTCTACGACCTAACATGCCAAGACCTTCCGCCGGCGATCGAGGAC
AACTACAACGAATTCTTCGGAAAGGATGTGGGACTTTTCTTCAGGTTCCTTGCCTGGGACCCAGTCGAACTCAAG
TCAGATCCAGAGGATCCTGCCCCTTCACTCCCATCCCAAGTGAAGACAGGTATTCTCGAAATTGCAGAACTCTTC
ATTAAACTATATCCTGATCAACTACAAAAATCACCGGCCGTAGAATCTTTTGTTCAAGGTGTCTGGAACCTTATC
GGGGCAAACAAGTTGCCCAGTGTCTCCGACGATCATCTTGTATCTCAATCTTTAAGATTCATTTCGACGGCTATA
CATTCGGGTTACTACAAACCCTTATTTTCCTCCCGCGAAACTATAAAATCTCTAGTGGAAGGTGTTGTCGTTTCC
AACATAGCATTGCGTGAGCATGAGGTCGAACAATTTGAGGACGATCCTTTGGAGTATATTAGGATGGATCTCGCA
CTTTCTTCTACCGGTCTTGATAGTGGAAGTCGACGCCTTGCAGCGGCAGATGTCCTTCGGTCTCTTGTTGGCGGT
GGTTATGAAGTTGATACAACTGAAATCGTCGGTTCCTTCATCAGCGCCGACCTCCAAGCTTATCGGTCCAATCCA
GCGGAAAATTGGAAGGCTAAAGATAGTGCCGTATTCATGATGACCGCTGTTGCTAGTAAAGGATCGACGACAAAA
CATGGGGTTACTTCGGTCAACCCTCTCGTCGATGTTGTTCAATTCTTCTCCGAGCATGTCTTTCAGGATCTTCAG
GCGCAAGATGGTACCGTACATCCCATCTTACAAGTGGATGCAATCCGTTTTCTTTATACATTCCGCAATCAATTG
ACCAAGCCTCAACTCCTTGCCGTTCTTCCTCTGCTTGCCCGTCATCTGACTTCCGGGAATTATGTTACCTACACA
TATGCAGCCATTGCCATCGATCGTATACTCATCATCAAGCAACACAATCAACTAATTTTCGCGCAGGCCGACATA
CATGATTATGCAGCAAATCTAGTGGACGCGCTCTTGACCAAGGTGGAGGTTGGGCAAACACCTGAAAAACTCGCC
GAAAATGACCATCTTATGCGCTGTACCATGCGGGTTATTCTTACTGCTCGACAAACTCTAACACCAACATATCAA
CAAATACTTGCACGACTTGTCAATATTCTTGGTATTATTTCTAAGAACCCGAGCAATCCTCACTTCGATCAGTTC
ATTTTCGAGTGCATCTCTGGGCTCATGAGGTTTGTTGTAGCGGGATCGCCCAACACGCTACCCGTTTTTGAGCAG
GCCCTATTCAACCCTTTCACTTTCATACTTCAACAAGATATTGATCAATTTATCCCTTATTCATTCCAAATTCTT
GCTCAAATGCTAGAATTACATGACAGGGACGTTCCGGAAGAATATCGAAATTTGTTACCATTCCTCCTCATGCCT
GCTATATGGCAACAAAAGGGTAGTATCCCTGGTCTCGTCAAACTCTTAAAAGCTTTCCTGGCGCGGGATAGTGCC
CGGATGCTTGCTACCGGCCAAGTGGCTTCTGTACTCGCGGTCGTTCAGCAACGTTTGATACCCTCCAAGGTTAAT
GATTCTTGGGGATTTGAACTTTTGAATTCTGTCGTTCAATACGTCCCACCCAACGATCTGCAACAGTATATGAAA
CCTGTCATTATGACCCTGCTTACTCGAATGCAAACAAGTAAGACGACCCAATATGAGTATCTTTTTGCTCGTTTC
ATTCTATATACCATTGCTCTCAATGTCGAGGGACTTGGACCGGACTACATGATTGCTGTGATTGAAGGAATTCAG
CCCAATCTTTGGTCACAGGTCCTGACCAATTTCATCATTCCTCAAGCACCCAAAGTCCCGCACAAGGACAGGAAA
ATTGCCGTCGTTGGTGTCACTCGGTTATTGTGTCAGAGTAAATACATGATGCAAGATGCATTTATTGGCGCCTGG
CCTCAGGCTTATCAAGCGCTCATAAAGCTCTTCAGCGAGCCGCAACACCTTTCGAAAAAGAACGATGAAGACCCT
CATGCTGGCATTACGGAAATTGATTATGAAGAACAAACAGCAGGTTATCAAGCGGCATATTCGCGATTAGCTGCA
TCTGAGATGCAAGAAGTGGATCCAGTAGCATACGTTTCTAATCCCCAACAGTTCTTCCAAGAACAGGTTGATCTC
CTCGAGAAGGCATATGGACCTCAGGTTCAAGCCTTGATGCGTCCTGCATAG
Gene >AgabiH97|118820
ATGGCCGAACTCCCTGCCCTCCTCGTCGCTTCTCTCAAGCCAGAAACAAGAAAACAGGCTGAACAGAACTTGAAC
TCAATCTCCCAACAACCAGGTTTTCTTGGGGCTCTCCTGCAGCTTGTTCTCAATGGATCGCAGGAACGCCCAGCG
CGGCTCGCCGCAAGTATCTACCTCAAAAATATTGCCAAATCCCGGTGGGATGAAGTGAGTTCTGCATATTCGCCA
GCTTAGGATTGAGTTAAACTCGCGTAGGAAGTGAATCCTCTCCCTGAACAAGACAAGGCAGCGCTACGGAATCAG
CTAGTGCCCGCCATGCTCGCTTTGTCCGGTCCAACAGATAAAACAATCCGTACCCAAATTGCGGAAGCAGTGTCT
CTCATAGCAGAACTCGACTTCCCCAGCAAATGGCCTGATCTTCTTGACGTCAGTCCTACTATCATCGCGGTAGGA
CGCCACCAATTGACTTGGTTTCCAGCAACTCGTCGGATCGCTATCGCCCACCGATTACAATGTCAATGTCGGAGT
TTTGGAAACTGCTCATTCAATATTCCGTCCATGGCGTGCTCAAGTACGATCTGACCCTCTCTTCACCGTCATCAA
TTTCGTGCTTTCCAAATTTATGGTCCCCTTCCTCGGACTTTTTCGTCAAACCTCTCAACTTCTCCTCGCGTCCGC
ACCATCTCCAAATCTTCCTGTCGTTGCACAAGCTATGGTTTTACTCATCGACGTATTCTACGACCTAACATGCCA
AGACCTTCCGCCGGCGATCGAGGACAACTACAACGAATTCTTCGGAAAGGATGTGGGACTTTTCTTCAGGTTCCT
TGCCTGGGACCCAGTCGAACTCAAGTCAGATGTGCGTTTGTTATACCTAATTAGACGATTCGCTTTTGTTTATTC
ATGTCCTCTTAGCCAGAGGATCCTGCCCCTTCACTCCCATCCCAAGTGAAGACAGGTATTCTCGAAATTGCAGAA
GTATGTTTTGCGTGTGTTGGAATCGCTCGCCTAACTAATATTATGCAAGCTCTTCATTAAACTATATCCTGATCA
ACTACAAAAATCACCGGCCGTAGAATCTTTTGTTCAAGGTGTCTGGAACCTTATCGGGGCAAACAAGTTGCCCAG
TGTCTCCGACGATCATGTAAGCTGTCTATACTAGCATTGCATCTTCAACTCATTCGTATGGCTAGCTTGTATCTC
AATCTTTAAGATTCATTTCGACGGCTATACATTCGGGTTACTACAAACCCTTATTTTCCTCCCGCGAAACTATAA
AATCTCTAGTGGAAGGTGTTGTCGTTTCCAACATAGCATTGCGTGAGCATGAGGTCGAACAATTTGAGGACGATC
CTTTGGAGTATATTAGGATGGATCTCGCACTTTCTTCTACCGGTCTTGATAGTGGAAGTCGACGCCTTGCAGCGG
CAGATGTCCTTCGGTCTCTTGTTGGCGGTGGTTATGAAGTTGATACAACTGAAATCGTCGGTTCCTTCATCAGCG
CCGACCTCCAAGCTTATCGGTCCAATCCAGCGGAAAATTGGAAGGCTAAAGATAGTGCCGTATTCATGATGACCG
CTGTTGCTAGTAAAGGATCGACGACAAAAGTGCGTTTAGTTATCAACAAATATAGCCCATGTTGATGTTTCGTTT
CAGCATGGGGTTACTTCGGTCAACCCTCTCGTCGATGTTGTTCAATTCTTCTCCGAGCATGTCTTTCAGGATCTT
CAGGCGCAAGATGGTACCGTACATCCCATCTTACAAGTGGATGCAATCCGTTTTCTTTATACATTCCGCAATCAA
GTAAGTGCAGTATGATTTCGGTATGTCACATCGTCTGATTTGCTTTTTGTAGTTGACCAAGCCTCAACTCCTTGC
CGTTCTTCCTCTGCTTGCCCGTCATCTGACTTCCGGGAATTATGTTACCTACACATATGCAGCCATTGCCATCGA
TCGTATACTCATCATCAAGCAACACAATCAACTAATGTGAGGAGTGTTCGATCTTGTGACTGGGTAATAGCTCAT
CAGCAGAGATCTAGTTTCGCGCAGGCCGACATACATGATTATGCAGCAAATCTAGTGGACGCGCTCTTGACCAAG
GTGGAGGTTGGGCAAACACCTGAAAAACTCGCCGAAAATGACCATCTTATGCGCTGTAAGTGGCTGACTATTTAT
ACTACTATAGGTGGGAACTAAGATAACAACAGGTACCATGCGGGTTATTCTTACTGCTCGACAAACTCTAACACC
AACATATCAACAAATACTTGCACGACTTGTCAATATTCTTGGTATTATTTCTAAGAACCCGAGCAATCCTCACTT
CGATCAGTTCATTTTCGAGTGCATCTCTGGGCTCATGAGGTATATAAGACCTTTGAATTTCGTGTTTAATATTAC
TAATGAATTTTTGCTTCAGGTTTGTTGTAGCGGGATCGCCCAACACGCTACCCGTTTTTGAGCAGGCCCTATTCA
ACCCTTTCACTTTCATACTTCAACAAGATATTGATCGTGGGTGTCATGATTCCATCATTATGTTCGAATTTTGGG
CTAATGAAGAGAAACAGAATTTATCCCTTATTCATTCCAAATTCTTGCTCAAATGCTAGAATTACATGACAGGGA
CGTTCCGGAAGAATATCGAAATTTGTTACCATTCCTCCTCATGCCTGCTATATGGCAACAAAAGGGTAGTATCCC
TGGTCTCGTCAAACTCTTAAAAGCTTTCCTGGCGCGGGATAGTGCCCGGATGCTTGCTACCGGCCAAGTGGCTTC
TGTACTCGCGGTCGTTCAGCAACGTTTGATACCCTCCAAGGTTAATGATTCTTGGGGATTTGAACTTTTGAATTC
TGTCGTTCAATACGTCCCACCGTAAGTATTCTCGGATTTCTTACCCCATCCACTGTAGCTAATTTATTTCTTTCT
TCCCAGCAACGATCTGCAACAGTATATGAAACCTGTCATTATGACCCTGCTTACTCGAATGCAAACAAGTAAGAC
GACCCAATATGAGTATCTTTTTGCTCGTTTCATTCTATATACCATTGCTCTCAATGTCGAGGGACTTGGACCGGA
CTACATGATTGCTGTGATTGAAGGAATTCAGCCCAAGTACGCCATACTCTTACCCCCTTTCTTTTGATGAGCCTT
GCTTATTTAACGATACGCTAGTCTTTGGTCACAGGTCCTGACCAATTTCATCATTCCTCAAGCACCCAAAGTCCC
GCACAAGGACAGGAAAATTGCCGTCGTTGGTGTCACTCGGTTATTGTGTCAGAGTAAATACATGATGCAAGATGC
ATTTATTGGCGCCTGGTGAGGTTTCCCTTTCAAACCTCGAATTGGCTTCTCTCTAATAGATTGATTTGATCCAGG
CCTCAGGCTTATCAAGCGCTCATAAAGCTCTTCAGCGAGCCGCAACACCTTTCGAAAAAGAACGATGAAGACCCT
CATGCTGGCATTACGGAAATTGATTATGAAGAACAAACAGCAGGTTATCAAGCGGCATATTCGCGATTAGCTGCA
TCTGAGATGCAAGAAGTGGATCCAGTAGCATACGTTTCTAATCCCCAACAGTTCTTCCAAGAACAGGTTGATCTC
CTCGAGAAGGCATATGGACCTCAGGTTCAAGCCTTGATGCGTCCTGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail