Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|118580
Gene name
Locationscaffold_9:1313534..1314124
Strand-
Gene length (bp)590
Transcript length (bp)255
Coding sequence length (bp)255
Protein length (aa) 85

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 13 30 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 0.35 0.00 0.80
Initials Initials knots 0.00 0.00 0.00
Pileal_Stipeal_center Stage I stipe center 0.00 0.00 0.00
Pileal_Stipeal_shell Stage I stipe shell 0.00 0.00 0.00
DIF_stipe_center Stage II stipe center 0.00 0.00 0.00
DIF_stipe_shell Stage II stipe shell 1.22 0.43 2.02
DIF_stipe_skin Stage II stipe skin 1.37 0.00 4.02
DIF_cap_skin Stage II cap skin 0.00 0.00 0.00
DIF_cap_tissue Stage II cap tissue 0.00 0.00 0.00
DIF_gill_tissue Stage II gill tissue 0.39 0.00 0.85
YFB_stipe_center Young fruiting body stipe center 0.00 0.00 0.00
YFB_stipe_shell Young fruiting body stipe shell 0.00 0.00 0.00
YFB_stipe_skin Young fruiting body stipe skin 0.35 0.00 0.82
YFB_cap_skin Young fruiting body cap skin 0.33 0.00 0.78
YFB_cap_tissue Young fruiting body cap tissue 0.61 0.00 2.13
YFB_gill_tissue Young fruiting body gill tissue 0.00 0.00 0.00
YFB_veil Young fruiting body veil 0.59 0.00 2.12

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 1.000000 no
Casing YFB_stipe_center 1.000000 no
Casing YFB_stipe_shell 1.000000 no
Casing YFB_stipe_skin 1.000000 no
Casing YFB_cap_skin 1.000000 no
Casing YFB_cap_tissue 0.860931 no
Casing YFB_gill_tissue 1.000000 no
Casing YFB_veil 0.861064 no
Casing Initials 1.000000 no
Casing Pileal_Stipeal_center 1.000000 no
Casing Pileal_Stipeal_shell 1.000000 no
Casing DIF_stipe_center 1.000000 no
Casing DIF_stipe_shell 0.684595 no
Casing DIF_stipe_skin 0.664245 no
Casing DIF_cap_skin 1.000000 no
Casing DIF_cap_tissue 1.000000 no
DIF_gill_tissue YFB_stipe_center 1.000000 no
DIF_gill_tissue YFB_stipe_shell 1.000000 no
DIF_gill_tissue YFB_stipe_skin 1.000000 no
DIF_gill_tissue YFB_cap_skin 1.000000 no
DIF_gill_tissue YFB_cap_tissue 0.867211 no
DIF_gill_tissue YFB_gill_tissue 1.000000 no
DIF_gill_tissue YFB_veil 0.867084 no
YFB_stipe_center YFB_stipe_shell 1.000000 no
YFB_stipe_center YFB_stipe_skin 1.000000 no
YFB_stipe_center YFB_cap_skin 1.000000 no
YFB_stipe_center YFB_cap_tissue 0.270854 no
YFB_stipe_center YFB_gill_tissue 1.000000 no
YFB_stipe_center YFB_veil 0.269746 no
YFB_stipe_shell YFB_stipe_skin 1.000000 no
YFB_stipe_shell YFB_cap_skin 1.000000 no
YFB_stipe_shell YFB_cap_tissue 0.270854 no
YFB_stipe_shell YFB_gill_tissue 1.000000 no
YFB_stipe_shell YFB_veil 0.269746 no
YFB_stipe_skin YFB_cap_skin 1.000000 no
YFB_stipe_skin YFB_cap_tissue 0.858600 no
YFB_stipe_skin YFB_gill_tissue 1.000000 no
YFB_stipe_skin YFB_veil 0.858688 no
YFB_cap_skin YFB_cap_tissue 0.858905 no
YFB_cap_skin YFB_gill_tissue 1.000000 no
YFB_cap_skin YFB_veil 0.858975 no
YFB_cap_tissue YFB_gill_tissue 0.268771 no
YFB_cap_tissue YFB_veil 0.911894 no
YFB_gill_tissue YFB_veil 0.269746 no
Initials DIF_gill_tissue 1.000000 no
Initials YFB_stipe_center 1.000000 no
Initials YFB_stipe_shell 1.000000 no
Initials YFB_stipe_skin 1.000000 no
Initials YFB_cap_skin 1.000000 no
Initials YFB_cap_tissue 0.270854 no
Initials YFB_gill_tissue 1.000000 no
Initials YFB_veil 0.269746 no
Initials Pileal_Stipeal_center 1.000000 no
Initials Pileal_Stipeal_shell 1.000000 no
Initials DIF_stipe_center 1.000000 no
Initials DIF_stipe_shell 0.145389 no
Initials DIF_stipe_skin 0.119761 no
Initials DIF_cap_skin 1.000000 no
Initials DIF_cap_tissue 1.000000 no
Pileal_Stipeal_center DIF_gill_tissue 1.000000 no
Pileal_Stipeal_center YFB_stipe_center 1.000000 no
Pileal_Stipeal_center YFB_stipe_shell 1.000000 no
Pileal_Stipeal_center YFB_stipe_skin 1.000000 no
Pileal_Stipeal_center YFB_cap_skin 1.000000 no
Pileal_Stipeal_center YFB_cap_tissue 0.270854 no
Pileal_Stipeal_center YFB_gill_tissue 1.000000 no
Pileal_Stipeal_center YFB_veil 0.269746 no
Pileal_Stipeal_center Pileal_Stipeal_shell 1.000000 no
Pileal_Stipeal_center DIF_stipe_center 1.000000 no
Pileal_Stipeal_center DIF_stipe_shell 0.145389 no
Pileal_Stipeal_center DIF_stipe_skin 0.119761 no
Pileal_Stipeal_center DIF_cap_skin 1.000000 no
Pileal_Stipeal_center DIF_cap_tissue 1.000000 no
Pileal_Stipeal_shell DIF_gill_tissue 1.000000 no
Pileal_Stipeal_shell YFB_stipe_center 1.000000 no
Pileal_Stipeal_shell YFB_stipe_shell 1.000000 no
Pileal_Stipeal_shell YFB_stipe_skin 1.000000 no
Pileal_Stipeal_shell YFB_cap_skin 1.000000 no
Pileal_Stipeal_shell YFB_cap_tissue 0.270854 no
Pileal_Stipeal_shell YFB_gill_tissue 1.000000 no
Pileal_Stipeal_shell YFB_veil 0.269746 no
Pileal_Stipeal_shell DIF_stipe_center 1.000000 no
Pileal_Stipeal_shell DIF_stipe_shell 0.145389 no
Pileal_Stipeal_shell DIF_stipe_skin 0.119761 no
Pileal_Stipeal_shell DIF_cap_skin 1.000000 no
Pileal_Stipeal_shell DIF_cap_tissue 1.000000 no
DIF_stipe_center DIF_gill_tissue 1.000000 no
DIF_stipe_center YFB_stipe_center 1.000000 no
DIF_stipe_center YFB_stipe_shell 1.000000 no
DIF_stipe_center YFB_stipe_skin 1.000000 no
DIF_stipe_center YFB_cap_skin 1.000000 no
DIF_stipe_center YFB_cap_tissue 0.270854 no
DIF_stipe_center YFB_gill_tissue 1.000000 no
DIF_stipe_center YFB_veil 0.269746 no
DIF_stipe_center DIF_stipe_shell 0.145389 no
DIF_stipe_center DIF_stipe_skin 0.119761 no
DIF_stipe_center DIF_cap_skin 1.000000 no
DIF_stipe_center DIF_cap_tissue 1.000000 no
DIF_stipe_shell DIF_gill_tissue 0.695870 no
DIF_stipe_shell YFB_stipe_center 0.147674 no
DIF_stipe_shell YFB_stipe_shell 0.147674 no
DIF_stipe_shell YFB_stipe_skin 0.696507 no
DIF_stipe_shell YFB_cap_skin 0.685296 no
DIF_stipe_shell YFB_cap_tissue 0.751908 no
DIF_stipe_shell YFB_gill_tissue 0.147674 no
DIF_stipe_shell YFB_veil 0.752207 no
DIF_stipe_shell DIF_stipe_skin 0.951369 no
DIF_stipe_shell DIF_cap_skin 0.147674 no
DIF_stipe_shell DIF_cap_tissue 0.147674 no
DIF_stipe_skin DIF_gill_tissue 0.663271 no
DIF_stipe_skin YFB_stipe_center 0.122909 no
DIF_stipe_skin YFB_stipe_shell 0.122909 no
DIF_stipe_skin YFB_stipe_skin 0.664562 no
DIF_stipe_skin YFB_cap_skin 0.631709 no
DIF_stipe_skin YFB_cap_tissue 0.735833 no
DIF_stipe_skin YFB_gill_tissue 0.122909 no
DIF_stipe_skin YFB_veil 0.736129 no
DIF_stipe_skin DIF_cap_skin 0.122909 no
DIF_stipe_skin DIF_cap_tissue 0.122909 no
DIF_cap_skin DIF_gill_tissue 1.000000 no
DIF_cap_skin YFB_stipe_center 1.000000 no
DIF_cap_skin YFB_stipe_shell 1.000000 no
DIF_cap_skin YFB_stipe_skin 1.000000 no
DIF_cap_skin YFB_cap_skin 1.000000 no
DIF_cap_skin YFB_cap_tissue 0.270854 no
DIF_cap_skin YFB_gill_tissue 1.000000 no
DIF_cap_skin YFB_veil 0.269746 no
DIF_cap_skin DIF_cap_tissue 1.000000 no
DIF_cap_tissue DIF_gill_tissue 1.000000 no
DIF_cap_tissue YFB_stipe_center 1.000000 no
DIF_cap_tissue YFB_stipe_shell 1.000000 no
DIF_cap_tissue YFB_stipe_skin 1.000000 no
DIF_cap_tissue YFB_cap_skin 1.000000 no
DIF_cap_tissue YFB_cap_tissue 0.270854 no
DIF_cap_tissue YFB_gill_tissue 1.000000 no
DIF_cap_tissue YFB_veil 0.269746 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|118580
MVAGVTRQCTSSVFFFFLFLFFLFFVAMNHPSRAYARLTRALCDTVCPRRHRQTVRDHSEYDCGRTSRHTTRGRA
SPLIHIELR*
Coding >AgabiH97|118580
ATGGTAGCTGGGGTGACTCGGCAGTGCACCAGCTCTGTTTTTTTTTTTTTTCTATTCCTATTCTTTCTTTTCTTT
GTTGCAATGAATCATCCATCAAGAGCATATGCGCGGTTAACCAGAGCGCTTTGTGACACGGTGTGCCCTCGACGC
CACCGTCAAACTGTTAGAGATCATTCAGAATACGACTGTGGTAGAACGTCCAGGCATACAACTAGGGGACGTGCT
TCTCCTTTGATACACATCGAACTACGATAG
Transcript >AgabiH97|118580
ATGGTAGCTGGGGTGACTCGGCAGTGCACCAGCTCTGTTTTTTTTTTTTTTCTATTCCTATTCTTTCTTTTCTTT
GTTGCAATGAATCATCCATCAAGAGCATATGCGCGGTTAACCAGAGCGCTTTGTGACACGGTGTGCCCTCGACGC
CACCGTCAAACTGTTAGAGATCATTCAGAATACGACTGTGGTAGAACGTCCAGGCATACAACTAGGGGACGTGCT
TCTCCTTTGATACACATCGAACTACGATAG
Gene >AgabiH97|118580
ATGGTAGCTGTACGTTCGTTTGACTTTTTTAAATCGCCTCTCGTCGCTAACTGGATGAACAAGGGGGTGACTCGG
CAGTGCACCAGCTCTGTTTTTTTTTTTTTTCTATTCCTATTCTTTCTTTTCTTTGTTGCAATGAATCATCCATCA
AGAGCATATGGTAAGTTTGTTTTTCATTGCTTGGACGTGTTCGCTGATTGTTTTGATTATAGCGCGGTTAACCAG
GTGAGTTTTGCTTTATTCGCTTGGTGATTATGAAACGTTTGGGCTTTTCTACTGGAGAGCGCTTTGTGACACGGT
GAGTCTGTCAAACGTTTTCGCTGGTGGATTTGTACTGCTCATTGAAGAAGGATAGGTGTGCCCTCGACGGTGAAC
GGCATATAAATTCGATGGTCACCCGTCTATCTCTCGCCTCGTTCAAGCCACCGTCAAACTGTTAGAGATCATTCA
GAATACGACTGTGGTAGAACGTCCAGGCATACAACTAGGTGCGTCTATTCTCCTTTCTTTCATCCAATCTCTGGC
TAATGCCTGTTTGACTTAACTTAAGGGGACGTGCTTCTCCTTTGATACACATCGAACTACGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail