Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|118500
Gene name
Locationscaffold_9:1298943..1299798
Strand-
Gene length (bp)855
Transcript length (bp)573
Coding sequence length (bp)573
Protein length (aa) 191

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04588 HIG_1_N Hypoxia induced protein conserved region 1.2E-20 21 72

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8P006|RCF1_COPC7 Respiratory supercomplex factor 1, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=RCF1 PE=3 SV=1 6 129 3.0E-41
sp|B0D4J7|RCF1_LACBS Respiratory supercomplex factor 1, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=RCF1 PE=3 SV=1 7 79 2.0E-33
sp|Q6CBQ8|RCF1_YARLI Respiratory supercomplex factor 1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RCF1 PE=3 SV=2 2 127 3.0E-13
sp|Q9BW72|HIG2A_HUMAN HIG1 domain family member 2A, mitochondrial OS=Homo sapiens GN=HIGD2A PE=1 SV=1 9 83 1.0E-12
sp|B6H465|RCF1_PENRW Respiratory supercomplex factor 1, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=rcf1 PE=3 SV=1 2 79 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8P006|RCF1_COPC7 Respiratory supercomplex factor 1, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=RCF1 PE=3 SV=1 6 129 3.0E-41
sp|B0D4J7|RCF1_LACBS Respiratory supercomplex factor 1, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=RCF1 PE=3 SV=1 7 79 2.0E-33
sp|Q6CBQ8|RCF1_YARLI Respiratory supercomplex factor 1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RCF1 PE=3 SV=2 2 127 3.0E-13
sp|Q9BW72|HIG2A_HUMAN HIG1 domain family member 2A, mitochondrial OS=Homo sapiens GN=HIGD2A PE=1 SV=1 9 83 1.0E-12
sp|B6H465|RCF1_PENRW Respiratory supercomplex factor 1, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=rcf1 PE=3 SV=1 2 79 2.0E-12
sp|A7TFU8|RCF1_VANPO Respiratory supercomplex factor 1, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RCF1 PE=3 SV=1 20 121 3.0E-12
sp|A3LVL1|RCF1_PICST Respiratory supercomplex factor 1, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RCF1 PE=3 SV=1 20 77 4.0E-12
sp|Q6CWT4|RCF1_KLULA Respiratory supercomplex factor 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RCF1 PE=3 SV=1 13 123 4.0E-12
sp|A1CHC5|RCF1_ASPCL Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rcf1 PE=3 SV=1 14 79 6.0E-12
sp|Q4PIK6|RCF1_USTMA Respiratory supercomplex factor 1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RCF1 PE=3 SV=1 13 119 9.0E-12
sp|Q6BIT1|RCF1_DEBHA Respiratory supercomplex factor 1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RCF1 PE=3 SV=2 18 81 1.0E-11
sp|Q9CQJ1|HIG2A_MOUSE HIG1 domain family member 2A OS=Mus musculus GN=Higd2a PE=3 SV=1 9 75 1.0E-11
sp|Q0CLP4|RCF1_ASPTN Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rcf1 PE=3 SV=1 14 79 1.0E-11
sp|A5DHC2|RCF1_PICGU Respiratory supercomplex factor 1, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RCF1 PE=3 SV=1 18 109 3.0E-11
sp|A1CXG2|RCF1_NEOFI Respiratory supercomplex factor 1, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rcf1 PE=3 SV=1 14 79 6.0E-11
sp|B8N9M0|RCF1_ASPFN Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rcf1 PE=3 SV=1 14 79 9.0E-11
sp|Q2UGQ3|RCF1_ASPOR Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rcf1 PE=3 SV=1 14 79 9.0E-11
sp|Q5B6J9|RCF1_EMENI Respiratory supercomplex factor 1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rcf1 PE=3 SV=1 14 79 1.0E-10
sp|Q875C2|RCF1_PODAN Respiratory supercomplex factor 1, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=RCF1 PE=3 SV=1 14 78 1.0E-10
sp|A2QI79|RCF1_ASPNC Respiratory supercomplex factor 1, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rcf1 PE=3 SV=1 14 76 1.0E-10
sp|Q4WP59|RCF1_ASPFU Respiratory supercomplex factor 1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rcf1 PE=3 SV=1 14 79 2.0E-10
sp|B0Y606|RCF1_ASPFC Respiratory supercomplex factor 1, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rcf1 PE=3 SV=1 14 79 2.0E-10
sp|Q03713|RCF1_YEAST Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCF1 PE=1 SV=1 20 80 2.0E-10
sp|C8ZEH4|RCF1_YEAS8 Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RCF1 PE=3 SV=1 20 80 2.0E-10
sp|A6ZM32|RCF1_YEAS7 Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=RCF1 PE=3 SV=1 20 80 2.0E-10
sp|C7GT60|RCF1_YEAS2 Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=RCF1 PE=3 SV=1 20 80 2.0E-10
sp|B3LLM2|RCF1_YEAS1 Respiratory supercomplex factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RCF1 PE=3 SV=1 20 80 2.0E-10
sp|Q2GMG9|RCF1_CHAGB Respiratory supercomplex factor 1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RCF1 PE=3 SV=1 9 82 2.0E-10
sp|C4QV79|RCF1_PICPG Respiratory supercomplex factor 1, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=RCF1 PE=3 SV=1 13 79 4.0E-10
sp|Q6FSW5|RCF1_CANGA Respiratory supercomplex factor 1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RCF1 PE=3 SV=1 11 123 6.0E-10
sp|Q7S455|RCF1_NEUCR Respiratory supercomplex factor 1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rcf1 PE=3 SV=2 14 78 7.0E-10
sp|A5E2M7|RCF1_LODEL Respiratory supercomplex factor 1, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RCF1 PE=3 SV=1 14 76 7.0E-10
sp|C5DWC4|RCF1_ZYGRC Respiratory supercomplex factor 1, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RCF1 PE=3 SV=1 13 127 1.0E-09
sp|B6K2Z6|RCF1_SCHJY Respiratory supercomplex factor 1, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rcf1 PE=3 SV=1 12 73 1.0E-09
sp|C4Y631|RCF1_CLAL4 Respiratory supercomplex factor 1, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=RCF1 PE=3 SV=1 20 79 1.0E-09
sp|A6SSX6|RCF1_BOTFB Respiratory supercomplex factor 1, mitochondrial OS=Botryotinia fuckeliana (strain B05.10) GN=rcf1 PE=3 SV=1 14 115 2.0E-09
sp|C5MAV2|RCF1_CANTT Respiratory supercomplex factor 1, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=RCF1 PE=3 SV=1 13 109 4.0E-09
sp|B6QHL9|RCF1A_TALMQ Respiratory supercomplex factor 1-A, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=rcf1-A PE=3 SV=1 14 79 5.0E-09
sp|B6QHL8|RCF1B_TALMQ Respiratory supercomplex factor 1-B, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=rcf1-B PE=3 SV=1 14 79 6.0E-09
sp|B8MJJ2|RCF1_TALSN Respiratory supercomplex factor 1, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=rcf1 PE=3 SV=1 14 79 7.0E-09
sp|C5DLZ7|RCF1_LACTC Respiratory supercomplex factor 1, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RCF1 PE=3 SV=1 20 143 1.0E-08
sp|C5P447|RCF1_COCP7 Respiratory supercomplex factor 1, mitochondrial OS=Coccidioides posadasii (strain C735) GN=RCF1 PE=3 SV=1 14 79 2.0E-08
sp|C4YRP9|RCF1_CANAW Respiratory supercomplex factor 1, mitochondrial OS=Candida albicans (strain WO-1) GN=RCF1 PE=3 SV=1 18 129 2.0E-08
sp|Q59N74|RCF1_CANAL Respiratory supercomplex factor 1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RCF1 PE=3 SV=1 18 109 3.0E-08
sp|B2WBP3|RCF1_PYRTR Respiratory supercomplex factor 1, mitochondrial OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=rcf1 PE=3 SV=1 13 77 3.0E-08
sp|C7YJ02|RCF1_NECH7 Respiratory supercomplex factor 1, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RCF1 PE=3 SV=1 17 77 7.0E-08
sp|B9WHT6|RCF1_CANDC Respiratory supercomplex factor 1, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=RCF1 PE=3 SV=1 18 154 8.0E-08
sp|Q756G1|RCF1_ASHGO Respiratory supercomplex factor 1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RCF1 PE=3 SV=1 11 76 9.0E-08
sp|C5FSQ7|RCF1_ARTOC Respiratory supercomplex factor 1, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=RCF1 PE=3 SV=1 14 79 1.0E-07
sp|Q9UTB1|YL87_SCHPO HIG1 domain-containing protein C25B8.07c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.07c PE=3 SV=1 12 94 1.0E-07
sp|D4DDK2|RCF1_TRIVH Respiratory supercomplex factor 1, mitochondrial OS=Trichophyton verrucosum (strain HKI 0517) GN=RCF1 PE=3 SV=1 14 82 2.0E-07
sp|C6H220|RCF1_AJECH Respiratory supercomplex factor 1, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=RCF1 PE=3 SV=1 14 76 3.0E-07
sp|C0NUL6|RCF1_AJECG Respiratory supercomplex factor 1, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=RCF1 PE=3 SV=1 14 76 3.0E-07
sp|A6RBB3|RCF1_AJECN Respiratory supercomplex factor 1, mitochondrial OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RCF1 PE=3 SV=1 14 76 3.0E-07
sp|C0RYW2|RCF1_PARBP Respiratory supercomplex factor 1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=RCF1 PE=3 SV=1 14 76 3.0E-07
sp|C1G794|RCF1_PARBD Respiratory supercomplex factor 1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=RCF1 PE=3 SV=1 14 76 3.0E-07
sp|Q7X843|ATL48_ARATH RING-H2 finger protein ATL48 OS=Arabidopsis thaliana GN=ATL48 PE=1 SV=2 1 73 6.0E-07
sp|A4RI25|RCF1_MAGO7 Respiratory supercomplex factor 1, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RCF1 PE=3 SV=1 14 76 8.0E-07
sp|Q0V4P1|RCF1_PHANO Respiratory supercomplex factor 1, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RCF1 PE=3 SV=1 13 115 1.0E-06
sp|Q4VC39|HIG2B_HUMAN Putative HIG1 domain family member 2B OS=Homo sapiens GN=HIGD2B PE=5 SV=1 9 75 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.5

Transmembrane Domains

Domain # Start End Length
1 24 41 17
2 54 76 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|118500
MDETQPGYEIWSDKFKRKFKENPWVPIGCLATTGALFMASVRMRHGKSQDMQYWLRARVLFQGVTVVALLAGTVA
FQAQGNRPVTDSGTESSTVANTEPLRGEKREKEKAEFEARLKDAEVAHAQEQAFLSHTPRSFSAAASAPTADKQQ
NMEQTTSPASGDSKGKTSFPEPYSTAALIELSFLWIGDNV*
Coding >AgabiH97|118500
ATGGATGAAACGCAGCCCGGCTATGAGATTTGGTCCGACAAATTCAAGCGTAAATTCAAAGAAAATCCATGGGTG
CCTATTGGCTGTTTAGCCACCACTGGCGCTCTCTTTATGGCCTCGGTTAGAATGCGCCACGGAAAATCTCAAGAC
ATGCAGTACTGGCTGCGCGCCCGTGTCTTGTTTCAAGGTGTCACTGTTGTCGCCCTCTTAGCCGGAACCGTGGCT
TTCCAAGCCCAAGGAAACCGACCAGTAACAGATTCCGGTACCGAATCGTCAACTGTCGCAAACACGGAGCCTCTA
CGAGGGGAAAAGAGGGAAAAAGAAAAGGCGGAATTCGAGGCACGGTTAAAGGATGCCGAAGTTGCGCATGCACAA
GAACAAGCTTTCTTATCACATACCCCTCGCAGTTTTTCAGCGGCTGCAAGTGCTCCTACCGCCGACAAGCAACAA
AATATGGAGCAAACAACGTCTCCGGCAAGTGGGGACTCGAAGGGCAAAACTAGTTTTCCGGAACCTTACTCGACA
GCCGCTTTAATTGAACTCTCATTTCTATGGATTGGTGACAACGTCTGA
Transcript >AgabiH97|118500
ATGGATGAAACGCAGCCCGGCTATGAGATTTGGTCCGACAAATTCAAGCGTAAATTCAAAGAAAATCCATGGGTG
CCTATTGGCTGTTTAGCCACCACTGGCGCTCTCTTTATGGCCTCGGTTAGAATGCGCCACGGAAAATCTCAAGAC
ATGCAGTACTGGCTGCGCGCCCGTGTCTTGTTTCAAGGTGTCACTGTTGTCGCCCTCTTAGCCGGAACCGTGGCT
TTCCAAGCCCAAGGAAACCGACCAGTAACAGATTCCGGTACCGAATCGTCAACTGTCGCAAACACGGAGCCTCTA
CGAGGGGAAAAGAGGGAAAAAGAAAAGGCGGAATTCGAGGCACGGTTAAAGGATGCCGAAGTTGCGCATGCACAA
GAACAAGCTTTCTTATCACATACCCCTCGCAGTTTTTCAGCGGCTGCAAGTGCTCCTACCGCCGACAAGCAACAA
AATATGGAGCAAACAACGTCTCCGGCAAGTGGGGACTCGAAGGGCAAAACTAGTTTTCCGGAACCTTACTCGACA
GCCGCTTTAATTGAACTCTCATTTCTATGGATTGGTGACAACGTCTGA
Gene >AgabiH97|118500
ATGGATGAAACGCAGCCCGGCTATGAGATTTGGTCCGACAAATTCAAGCGTAAATTCAAAGAAAATCCATGGGTG
CCTATTGGTATGAAAAACCAGCTTTCTTTGACGTTGTATACTTACAATCTTTCAACAGGCTGTTTAGCCACCACT
GGCGCTCTCTTTATGGCCTCGGTTAGAATGCGCCACGGAAAATCTCAAGACATGCAGTACTGGCTGCGCGCCCGT
GTCTTGTTTCAAGGTGTCACTGTTGTCGCCCTCTTAGCCGGAACCGTGGCTTTCCAAGCCCAAGGAAACCGACCA
GTAACAGATTCCGGTACGTCATATTTGTTTGATCGCCCCCTTCCGCTTCGCAAGCATTCCCCTTCCACGTTTTGT
TCTTGCTTCTTTTGAAAAGGAAGAAAACATTCCAATACAGGTCTTGTAGGTACCGAATCGTCAACTGTCGCAAAC
ACGGAGCCTCTACGAGGGGAAAAGAGGGAAAAAGAAAAGGCGGAATTCGAGGCACGGTTAAAGGATGCCGAAGTT
GCGCATGCACAAGAACAAGCTTTCTTATCACATACCCCTCGCAGTTTTTCAGCGGCTGCAAGTGCTCCTACCGCC
GACAAGCAACAAAATATGGAGCAAACAACGTCTCCGGCAAGTGGGGACTCGAAGGGCAAAAGTTCGTGGAGGCGG
TGGCTTTGGGGGTCTGGAGACTCGAATAAAAGCTAGTAATTGTCTTGTCTACTATTCTCTACTTGCAACCTCCTG
GGTACTGAATACTATTTGCTGGATATGTCATCAGGTTTTCCGGAACCTTACTCGACAGCCGCTTTAATTGAACTC
TCATTTCTATGGATTGGTGACAACGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail