Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|118310
Gene name
Locationscaffold_9:1237557..1240230
Strand-
Gene length (bp)2673
Transcript length (bp)2508
Coding sequence length (bp)2508
Protein length (aa) 836

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 1.7E-24 75 175

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 45 175 3.0E-25
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 46 174 1.0E-20
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 45 148 4.0E-14
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 57 174 6.0E-08
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 57 174 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 45 175 3.0E-25
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 46 174 1.0E-20
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 45 148 4.0E-14
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 57 174 6.0E-08
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 57 174 6.0E-08
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 57 174 6.0E-08
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 55 174 1.0E-07
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 55 174 1.0E-07
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 55 174 1.0E-07
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 55 174 1.0E-07
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 55 174 1.0E-07
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 55 174 1.0E-07
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 55 174 1.0E-07
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 57 174 1.0E-07
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 57 174 1.0E-07
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 57 174 2.0E-07
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 57 174 2.0E-07
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 57 174 2.0E-07
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 55 174 2.0E-07
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 57 174 2.0E-07
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 57 174 2.0E-07
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 57 174 2.0E-07
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 57 174 2.0E-07
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 57 174 2.0E-07
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 55 174 2.0E-07
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 55 174 2.0E-07
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 55 174 2.0E-07
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 57 174 3.0E-07
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 61 174 3.0E-07
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 57 174 3.0E-07
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 57 174 3.0E-07
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 57 174 3.0E-07
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 57 174 3.0E-07
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 57 174 3.0E-07
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 57 174 3.0E-07
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 57 174 3.0E-07
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 57 174 3.0E-07
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 57 174 3.0E-07
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 57 174 3.0E-07
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 61 174 4.0E-07
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 57 174 4.0E-07
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 61 174 4.0E-07
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 57 174 4.0E-07
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 55 174 9.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|118310
MLLISTSLLSAALIASTSDSDDEAALLADSEYCEVEFAGAVSGADPRSYRLAMKSPDSDCWTEACNTEIFNLEAN
GTWELMELPPGKKVVNSGWVFKVKRLADDSMERYRAHLVAKGYSQRPGFDFTKVFAPTFRPASLRLIIALAAREG
YKMCSVDISSAFTYGELEEEIYMRQHTLLDLLPLPSSFGSLSASRLQSQPASTPYPSRPPSQAPSPPANPTATRL
TVSDIGVLLDPQYGGQIVLSTFGYDSQENRAIMDAVRNRGIAPEVAIANAAARAESKGNVKGPSGQSSGIGAAPP
AVKTPPRVPTPPPRVPTPPPPVPTRPLSPPRAPLPSASVLSSKRPISPGSSSSGPSVAAVLVCDSDDSSMALDYE
DAITPRPASPEDEEHLDSKESAEAVVSIINNAVEIFEALSSSKWKTHIIDAFPTIMDNDVSLIHSAFMEKFPLLR
RIFSPAVVAPAPAVDAPATCVNLRDAQPPAESAKSKPPKKKVRVDPAPSSDVTPSATAPLMEVDEPAAPPPASGK
APTKPLPVPSSKRAPAPKDAAPVSFRAPSAPRKRRQGKHTAHGASRRAIILTPPADSPVTAASFTPEIINSLNKL
IKNDIKSDVILTHASVEGNGIGIAASRVPSPAEIVFVLKHARRLFPSLNVPIAHSPITSTSYLKIVDIPHVPASS
KEWALKQHEAFTSALNKSPVGASWPNLSNTSRASCAPRLTPTHAGHGLTFTTQCRAPTLGSTFPSLCPSAARTVR
SRALALTPALFTALVVSAGAIIPTSVAPSVPAAPSVLVLTPRPITSTKRPADKRSHSSADSKVCPFWKNRFDRAW
LKRQFPARST*
Coding >AgabiH97|118310
ATGCTGCTCATATCAACCTCTCTGTTATCCGCCGCATTGATCGCCTCCACCTCTGACTCTGATGACGAAGCTGCT
CTGCTAGCTGACTCTGAGTACTGTGAAGTCGAGTTTGCTGGAGCCGTTTCGGGTGCTGATCCCCGGAGTTATAGA
CTAGCTATGAAGTCTCCTGACTCGGATTGCTGGACTGAGGCTTGTAACACTGAGATCTTTAATCTCGAGGCTAAT
GGAACTTGGGAGTTAATGGAACTGCCTCCAGGCAAGAAGGTAGTCAACTCTGGCTGGGTGTTCAAAGTCAAACGA
CTTGCCGACGACTCAATGGAGCGCTACCGGGCTCATCTCGTTGCCAAAGGCTATTCCCAACGTCCTGGATTCGAC
TTCACCAAGGTCTTTGCCCCTACATTTCGTCCTGCGTCACTACGCCTCATTATTGCTCTTGCAGCTAGAGAAGGC
TACAAAATGTGCTCCGTCGACATCTCTTCTGCCTTCACCTATGGAGAACTCGAAGAAGAGATCTATATGCGCCAA
CACACGCTCCTTGACCTCTTACCACTACCTTCCTCTTTTGGAAGTCTCAGTGCTAGTCGTCTACAATCCCAACCG
GCCTCAACGCCATACCCGTCCCGTCCCCCGTCTCAGGCGCCGTCACCGCCCGCCAACCCTACCGCCACTCGCCTC
ACTGTCTCCGACATTGGGGTACTGCTCGACCCTCAATACGGAGGTCAAATCGTACTCAGTACATTCGGCTACGAC
TCGCAAGAGAACAGAGCCATCATGGACGCCGTCCGCAACCGGGGCATTGCCCCTGAGGTCGCTATCGCCAACGCC
GCTGCTCGCGCCGAGAGCAAAGGTAATGTCAAAGGGCCATCTGGCCAATCTTCTGGGATCGGTGCAGCCCCCCCG
GCTGTCAAGACACCGCCCAGAGTCCCTACTCCTCCACCTCGTGTGCCGACGCCTCCGCCGCCGGTGCCCACTCGT
CCCCTTTCCCCTCCTCGCGCACCGTTGCCTTCGGCTTCGGTGCTTTCCTCGAAGCGCCCCATCTCGCCGGGGTCT
TCCTCTTCCGGTCCTTCTGTCGCTGCCGTTTTGGTATGCGACAGTGACGACTCTTCTATGGCCCTCGACTACGAG
GATGCCATCACTCCCCGTCCTGCTTCTCCTGAAGATGAGGAGCATTTGGACAGCAAAGAATCCGCCGAGGCTGTT
GTTTCAATTATCAACAACGCTGTCGAAATTTTCGAGGCGCTATCTTCCTCCAAATGGAAGACACACATTATCGAC
GCCTTCCCCACCATCATGGATAACGATGTCAGTCTTATTCATTCAGCATTCATGGAGAAATTCCCCCTTCTCCGT
CGTATCTTCTCCCCGGCAGTTGTTGCGCCTGCACCCGCAGTTGACGCACCTGCCACATGTGTAAATCTGCGGGAC
GCACAGCCACCCGCTGAGTCAGCCAAGTCCAAGCCTCCGAAGAAGAAGGTTCGGGTCGATCCGGCCCCATCTTCT
GACGTCACTCCCTCAGCAACGGCCCCACTCATGGAAGTGGATGAGCCGGCCGCTCCACCTCCAGCGTCTGGGAAG
GCGCCCACCAAACCCCTTCCCGTCCCAAGTTCAAAGCGCGCGCCTGCACCTAAAGACGCCGCCCCAGTTTCCTTC
CGCGCTCCTTCGGCGCCTCGTAAGAGACGCCAAGGCAAGCACACTGCACACGGCGCTTCGCGCCGTGCTATAATC
CTGACACCGCCCGCGGACTCTCCGGTTACGGCGGCTTCTTTCACTCCCGAGATTATTAATAGTCTCAACAAGCTC
ATCAAGAATGACATCAAGTCTGATGTCATCTTAACCCATGCTTCGGTCGAAGGCAACGGCATTGGTATTGCCGCC
TCCCGTGTCCCCTCCCCCGCCGAAATTGTGTTCGTGCTCAAGCACGCTCGGCGACTATTCCCGAGCCTGAACGTT
CCCATCGCTCACTCTCCCATCACGTCGACTTCATATTTGAAGATCGTCGACATCCCACACGTGCCCGCTTCCTCT
AAGGAGTGGGCACTCAAGCAACATGAGGCGTTCACTAGCGCTCTCAACAAATCCCCGGTCGGCGCTTCCTGGCCA
AACTTATCAAACACAAGCCGCGCTTCATGCGCGCCTCGCCTCACTCCGACTCATGCTGGGCATGGGTTGACATTC
ACGACACAGTGTCGGGCTCCAACGCTCGGCTCTACCTTTCCAAGTTTGTGTCCATCGGCGGCACGAACTGTCAGA
TCAAGGGCGCTCGCCCTCACTCCGGCTCTGTTCACTGCGCTCGTTGTCAGCGCTGGGGCCATCATTCCGACCAGT
GTCGCGCCAAGTGTGCCCGCTGCTCCCTCTGTTCTGGTCCTCACTCCGAGGCCAATCACTTCAACGAAACGCCCA
GCGGACAAGCGCTCCCATTCCTCTGCGGACTCGAAGGTCTGTCCGTTTTGGAAAAACAGGTTCGATCGTGCCTGG
CTCAAACGCCAGTTCCCCGCGCGTTCGACTTGA
Transcript >AgabiH97|118310
ATGCTGCTCATATCAACCTCTCTGTTATCCGCCGCATTGATCGCCTCCACCTCTGACTCTGATGACGAAGCTGCT
CTGCTAGCTGACTCTGAGTACTGTGAAGTCGAGTTTGCTGGAGCCGTTTCGGGTGCTGATCCCCGGAGTTATAGA
CTAGCTATGAAGTCTCCTGACTCGGATTGCTGGACTGAGGCTTGTAACACTGAGATCTTTAATCTCGAGGCTAAT
GGAACTTGGGAGTTAATGGAACTGCCTCCAGGCAAGAAGGTAGTCAACTCTGGCTGGGTGTTCAAAGTCAAACGA
CTTGCCGACGACTCAATGGAGCGCTACCGGGCTCATCTCGTTGCCAAAGGCTATTCCCAACGTCCTGGATTCGAC
TTCACCAAGGTCTTTGCCCCTACATTTCGTCCTGCGTCACTACGCCTCATTATTGCTCTTGCAGCTAGAGAAGGC
TACAAAATGTGCTCCGTCGACATCTCTTCTGCCTTCACCTATGGAGAACTCGAAGAAGAGATCTATATGCGCCAA
CACACGCTCCTTGACCTCTTACCACTACCTTCCTCTTTTGGAAGTCTCAGTGCTAGTCGTCTACAATCCCAACCG
GCCTCAACGCCATACCCGTCCCGTCCCCCGTCTCAGGCGCCGTCACCGCCCGCCAACCCTACCGCCACTCGCCTC
ACTGTCTCCGACATTGGGGTACTGCTCGACCCTCAATACGGAGGTCAAATCGTACTCAGTACATTCGGCTACGAC
TCGCAAGAGAACAGAGCCATCATGGACGCCGTCCGCAACCGGGGCATTGCCCCTGAGGTCGCTATCGCCAACGCC
GCTGCTCGCGCCGAGAGCAAAGGTAATGTCAAAGGGCCATCTGGCCAATCTTCTGGGATCGGTGCAGCCCCCCCG
GCTGTCAAGACACCGCCCAGAGTCCCTACTCCTCCACCTCGTGTGCCGACGCCTCCGCCGCCGGTGCCCACTCGT
CCCCTTTCCCCTCCTCGCGCACCGTTGCCTTCGGCTTCGGTGCTTTCCTCGAAGCGCCCCATCTCGCCGGGGTCT
TCCTCTTCCGGTCCTTCTGTCGCTGCCGTTTTGGTATGCGACAGTGACGACTCTTCTATGGCCCTCGACTACGAG
GATGCCATCACTCCCCGTCCTGCTTCTCCTGAAGATGAGGAGCATTTGGACAGCAAAGAATCCGCCGAGGCTGTT
GTTTCAATTATCAACAACGCTGTCGAAATTTTCGAGGCGCTATCTTCCTCCAAATGGAAGACACACATTATCGAC
GCCTTCCCCACCATCATGGATAACGATGTCAGTCTTATTCATTCAGCATTCATGGAGAAATTCCCCCTTCTCCGT
CGTATCTTCTCCCCGGCAGTTGTTGCGCCTGCACCCGCAGTTGACGCACCTGCCACATGTGTAAATCTGCGGGAC
GCACAGCCACCCGCTGAGTCAGCCAAGTCCAAGCCTCCGAAGAAGAAGGTTCGGGTCGATCCGGCCCCATCTTCT
GACGTCACTCCCTCAGCAACGGCCCCACTCATGGAAGTGGATGAGCCGGCCGCTCCACCTCCAGCGTCTGGGAAG
GCGCCCACCAAACCCCTTCCCGTCCCAAGTTCAAAGCGCGCGCCTGCACCTAAAGACGCCGCCCCAGTTTCCTTC
CGCGCTCCTTCGGCGCCTCGTAAGAGACGCCAAGGCAAGCACACTGCACACGGCGCTTCGCGCCGTGCTATAATC
CTGACACCGCCCGCGGACTCTCCGGTTACGGCGGCTTCTTTCACTCCCGAGATTATTAATAGTCTCAACAAGCTC
ATCAAGAATGACATCAAGTCTGATGTCATCTTAACCCATGCTTCGGTCGAAGGCAACGGCATTGGTATTGCCGCC
TCCCGTGTCCCCTCCCCCGCCGAAATTGTGTTCGTGCTCAAGCACGCTCGGCGACTATTCCCGAGCCTGAACGTT
CCCATCGCTCACTCTCCCATCACGTCGACTTCATATTTGAAGATCGTCGACATCCCACACGTGCCCGCTTCCTCT
AAGGAGTGGGCACTCAAGCAACATGAGGCGTTCACTAGCGCTCTCAACAAATCCCCGGTCGGCGCTTCCTGGCCA
AACTTATCAAACACAAGCCGCGCTTCATGCGCGCCTCGCCTCACTCCGACTCATGCTGGGCATGGGTTGACATTC
ACGACACAGTGTCGGGCTCCAACGCTCGGCTCTACCTTTCCAAGTTTGTGTCCATCGGCGGCACGAACTGTCAGA
TCAAGGGCGCTCGCCCTCACTCCGGCTCTGTTCACTGCGCTCGTTGTCAGCGCTGGGGCCATCATTCCGACCAGT
GTCGCGCCAAGTGTGCCCGCTGCTCCCTCTGTTCTGGTCCTCACTCCGAGGCCAATCACTTCAACGAAACGCCCA
GCGGACAAGCGCTCCCATTCCTCTGCGGACTCGAAGGTCTGTCCGTTTTGGAAAAACAGGTTCGATCGTGCCTGG
CTCAAACGCCAGTTCCCCGCGCGTTCGACTTGA
Gene >AgabiH97|118310
ATGCTGCTCATATCAACCTCTCTGTTATCCGCCGCATTGTACGTGTTGTGAAGAGTTTCAAACAACTTCTCCTCA
TTGTTGCATGAATTTCCTTCACTATCTAGGATCGCCTCCACCTCTGACTCTGATGACGAAGCTGCTCTGCTAGCT
GACTCTGAGTACTGTGAAGTCGAGTTTGCTGGAGCCGTTTCGGGTGCTGATCCCCGGAGTTATAGACTAGCTATG
AAGTCTCCTGACTCGGATTGCTGGACTGAGGCTTGTAACACTGAGATCTTTAATCTCGAGGCTAATGGAACTTGG
GAGTTAATGGAACTGCCTCCAGGCAAGAAGGTAGTCAACTCTGGCTGGGTGTTCAAAGTCAAACGACTTGCCGAC
GACTCAATGGAGCGCTACCGGGCTCATCTCGTTGCCAAAGGCTATTCCCAACGTCCTGGATTCGACTTCACCAAG
GTCTTTGCCCCTACATTTCGTCCTGCGTCACTACGCCTCATTATTGCTCTTGCAGCTAGAGAAGGCTACAAAATG
TGCTCCGTCGACATCTCTTCTGCCTTCACCTATGGAGAACTCGAAGAAGAGATCTATATGCGCCAACACACGCTC
CTTGACCTCTTACCACTACCTTCCTCTTTTGGAAGTCTCAGTGCTAGTCGTCTAGTAGTAGCAATACATCGTCAG
TATGCCCGCTCCGCGTCGCAAACAGCAATCCCAACCGGCCTCAACGCCATACCCGTCCCGTCCCCCGTCTCAGGC
GCCGTCACCGCCCGCCAACCCTACCGCCACTCGCCTCACTGTCTCCGACATTGGGGTACTGCTCGACCCTCAATA
CGGAGGTCAAATCGTACTCAGTACATTCGGCTACGACTCGCAAGAGAACAGAGCCATCATGGACGCCGTCCGCAA
CCGGGGCATTGCCCCTGAGGTCGCTATCGCCAACGCCGCTGCTCGCGCCGAGAGCAAAGGTAATGTCAAAGGGCC
ATCTGGCCAATCTTCTGGGATCGGTGCAGCCCCCCCGGCTGTCAAGACACCGCCCAGAGTCCCTACTCCTCCACC
TCGTGTGCCGACGCCTCCGCCGCCGGTGCCCACTCGTCCCCTTTCCCCTCCTCGCGCACCGTTGCCTTCGGCTTC
GGTGCTTTCCTCGAAGCGCCCCATCTCGCCGGGGTCTTCCTCTTCCGGTCCTTCTGTCGCTGCCGTTTTGGTATG
CGACAGTGACGACTCTTCTATGGCCCTCGACTACGAGGATGCCATCACTCCCCGTCCTGCTTCTCCTGAAGATGA
GGAGCATTTGGACAGCAAAGAATCCGCCGAGGCTGTTGTTTCAATTATCAACAACGCTGTCGAAATTTTCGAGGC
GCTATCTTCCTCCAAATGGAAGACACACATTATCGACGCCTTCCCCACCATCATGGATAACGATGTCAGTCTTAT
TCATTCAGCATTCATGGAGAAATTCCCCCTTCTCCGTCGTATCTTCTCCCCGGCAGTTGTTGCGCCTGCACCCGC
AGTTGACGCACCTGCCACATGTGTAAATCTGCGGGACGCACAGCCACCCGCTGAGTCAGCCAAGTCCAAGCCTCC
GAAGAAGAAGGTTCGGGTCGATCCGGCCCCATCTTCTGACGTCACTCCCTCAGCAACGGCCCCACTCATGGAAGT
GGATGAGCCGGCCGCTCCACCTCCAGCGTCTGGGAAGGCGCCCACCAAACCCCTTCCCGTCCCAAGTTCAAAGCG
CGCGCCTGCACCTAAAGACGCCGCCCCAGTTTCCTTCCGCGCTCCTTCGGCGCCTCGTAAGAGACGCCAAGGCAA
GCACACTGCACACGGCGCTTCGCGCCGTGCTATAATCCTGACACCGCCCGCGGACTCTCCGGTTACGGCGGCTTC
TTTCACTCCCGAGATTATTAATAGTCTCAACAAGCTCATCAAGAATGACATCAAGTCTGATGTCATCTTAACCCA
TGCTTCGGTCGAAGGCAACGGCATTGGTATTGCCGCCTCCCGTGTCCCCTCCCCCGCCGAAATTGTGTTCGTGCT
CAAGCACGCTCGGCGACTATTCCCGAGCCTGAACGTTCCCATCGCTCACTCTCCCATCACGTCGACTTCATATTT
GAAGATCGTCGACATCCCACACGTGCCCGCTTCCTCTAAGGAGTGGGCACTCAAGCAACATGAGGCGTTCACTAG
CGCTCTCAACAAATCCCCGGTCGGCGCTTCCTGGCCAAACTTATCAAACACAAGCCGCGCTTCATGCGCGCCTCG
CCTCACTCCGACTCATGCTGGGCATGGGTTGACATTCACGACACAGTGTCGGGCTCCAACGCTCGGCTCTACCTT
TCCAAGTTTGTGTCCATCGGCGGCACGAACTGTCAGATCAAGGGCGCTCGCCCTCACTCCGGCTCTGTTCACTGC
GCTCGTTGTCAGCGCTGGGGCCATCATTCCGACCAGTGTCGCGCCAAGTGTGCCCGCTGCTCCCTCTGTTCTGGT
CCTCACTCCGAGGCCAATCACTTCAAGTGCGTCGACGCTAAACGCGCCGACGTGCGCCAATGCGCAAATTGTACC
GCAGCGAAACGCCCAGCGGACAAGCGCTCCCATTCCTCTGCGGACTCGAAGGTCTGTCCGTTTTGGAAAAACAGG
TTCGATCGTGCCTGGCTCAAACGCCAGTTCCCCGCGCGTTCGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail