Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|117990
Gene name
Locationscaffold_9:1168562..1169215
Strand-
Gene length (bp)653
Transcript length (bp)600
Coding sequence length (bp)600
Protein length (aa) 200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 8.0E-09 139 190

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 96 190 1.0E-13
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 109 190 1.0E-11
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 110 185 3.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|117990
MKGVIITSLLLVLRLPLLIPPFIPPVIPPVTPPQIHAPLPVTPPTAGAPLEPPHVPRRTGRVRKPPGQWWKLKQP
DLAGNDSDSDDEAALLADSEYCEVEFAGAVSGADPRSYRLAMKSPDSDCWTEACNTEIFNLEANGTWELMELPPG
KKVVNSGWVFKVKRLADGSIERYRARLVAKGYSQRPGFLFHCLAACLRP*
Coding >AgabiH97|117990
ATGAAGGGGGTGATAATCACATCCCTCCTGCTCGTCCTAAGACTCCCACTCCTAATTCCTCCATTCATTCCTCCT
GTGATTCCTCCAGTCACTCCTCCACAAATCCATGCACCTCTCCCAGTCACTCCTCCTACTGCCGGAGCCCCTCTT
GAGCCCCCTCACGTTCCTAGACGTACTGGGCGAGTTCGGAAGCCTCCTGGTCAATGGTGGAAGCTCAAACAACCT
GACTTAGCTGGTAATGACTCTGACTCTGATGACGAAGCTGCTCTGCTAGCTGACTCTGAGTACTGTGAAGTCGAG
TTTGCTGGAGCCGTTTCGGGTGCTGATCCCCGGAGTTATAGACTAGCTATGAAGTCTCCTGACTCGGATTGCTGG
ACTGAGGCTTGTAACACTGAGATATTCAATCTCGAGGCTAATGGGACTTGGGAGCTCATGGAACTGCCTCCTGGC
AAGAAGGTAGTCAACTCTGGCTGGGTGTTCAAAGTGAAACGACTTGCCGACGGCTCAATTGAGCGCTACCGGGCT
CGTCTTGTTGCTAAAGGCTATTCCCAACGCCCCGGATTCTTATTCCATTGCCTAGCAGCCTGCTTGAGGCCATAG
Transcript >AgabiH97|117990
ATGAAGGGGGTGATAATCACATCCCTCCTGCTCGTCCTAAGACTCCCACTCCTAATTCCTCCATTCATTCCTCCT
GTGATTCCTCCAGTCACTCCTCCACAAATCCATGCACCTCTCCCAGTCACTCCTCCTACTGCCGGAGCCCCTCTT
GAGCCCCCTCACGTTCCTAGACGTACTGGGCGAGTTCGGAAGCCTCCTGGTCAATGGTGGAAGCTCAAACAACCT
GACTTAGCTGGTAATGACTCTGACTCTGATGACGAAGCTGCTCTGCTAGCTGACTCTGAGTACTGTGAAGTCGAG
TTTGCTGGAGCCGTTTCGGGTGCTGATCCCCGGAGTTATAGACTAGCTATGAAGTCTCCTGACTCGGATTGCTGG
ACTGAGGCTTGTAACACTGAGATATTCAATCTCGAGGCTAATGGGACTTGGGAGCTCATGGAACTGCCTCCTGGC
AAGAAGGTAGTCAACTCTGGCTGGGTGTTCAAAGTGAAACGACTTGCCGACGGCTCAATTGAGCGCTACCGGGCT
CGTCTTGTTGCTAAAGGCTATTCCCAACGCCCCGGATTCTTATTCCATTGCCTAGCAGCCTGCTTGAGGCCATAG
Gene >AgabiH97|117990
ATGAAGGGGGTGATAATCACATCCCTCCTGCTCGTCCTAAGACTCCCACTCCGTCCGCTTCAGTTCCTCCTGAAG
AGAAGCCAGTTCTACCTCTACCACTTCCAGTAATTCCTCCATTCATTCCTCCTGTGATTCCTCCAGTCACTCCTC
CACAAATCCATGCACCTCTCCCAGTCACTCCTCCTACTGCCGGAGCCCCTCTTGAGCCCCCTCACGTTCCTAGAC
GTACTGGGCGAGTTCGGAAGCCTCCTGGTCAATGGTGGAAGCTCAAACAACCTGACTTAGCTGGTAATGACTCTG
ACTCTGATGACGAAGCTGCTCTGCTAGCTGACTCTGAGTACTGTGAAGTCGAGTTTGCTGGAGCCGTTTCGGGTG
CTGATCCCCGGAGTTATAGACTAGCTATGAAGTCTCCTGACTCGGATTGCTGGACTGAGGCTTGTAACACTGAGA
TATTCAATCTCGAGGCTAATGGGACTTGGGAGCTCATGGAACTGCCTCCTGGCAAGAAGGTAGTCAACTCTGGCT
GGGTGTTCAAAGTGAAACGACTTGCCGACGGCTCAATTGAGCGCTACCGGGCTCGTCTTGTTGCTAAAGGCTATT
CCCAACGCCCCGGATTCTTATTCCATTGCCTAGCAGCCTGCTTGAGGCCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail