Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|117590
Gene name
Locationscaffold_9:1058300..1059791
Strand+
Gene length (bp)1491
Transcript length (bp)1170
Coding sequence length (bp)1170
Protein length (aa) 390

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 7.7E-16 102 181

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7TQ20|DNJC2_RAT DnaJ homolog subfamily C member 2 OS=Rattus norvegicus GN=Dnajc2 PE=1 SV=1 93 383 1.0E-70
sp|Q9Y7I8|ZUO1_SCHPO Zuotin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zuo1 PE=1 SV=2 21 372 1.0E-69
sp|Q6NWJ4|DNJC2_DANRE DnaJ homolog subfamily C member 2 OS=Danio rerio GN=dnajc2 PE=2 SV=1 93 361 2.0E-64
sp|Q1RMH9|DNJC2_BOVIN DnaJ homolog subfamily C member 2 OS=Bos taurus GN=DNAJC2 PE=2 SV=1 93 383 2.0E-63
sp|Q4R8H2|DNJC2_MACFA DnaJ homolog subfamily C member 2 OS=Macaca fascicularis GN=DNAJC2 PE=2 SV=1 93 383 5.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7TQ20|DNJC2_RAT DnaJ homolog subfamily C member 2 OS=Rattus norvegicus GN=Dnajc2 PE=1 SV=1 93 383 1.0E-70
sp|Q9Y7I8|ZUO1_SCHPO Zuotin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zuo1 PE=1 SV=2 21 372 1.0E-69
sp|Q6NWJ4|DNJC2_DANRE DnaJ homolog subfamily C member 2 OS=Danio rerio GN=dnajc2 PE=2 SV=1 93 361 2.0E-64
sp|Q1RMH9|DNJC2_BOVIN DnaJ homolog subfamily C member 2 OS=Bos taurus GN=DNAJC2 PE=2 SV=1 93 383 2.0E-63
sp|Q4R8H2|DNJC2_MACFA DnaJ homolog subfamily C member 2 OS=Macaca fascicularis GN=DNAJC2 PE=2 SV=1 93 383 5.0E-63
sp|Q99543|DNJC2_HUMAN DnaJ homolog subfamily C member 2 OS=Homo sapiens GN=DNAJC2 PE=1 SV=4 93 383 6.0E-63
sp|P54103|DNJC2_MOUSE DnaJ homolog subfamily C member 2 OS=Mus musculus GN=Dnajc2 PE=1 SV=2 93 383 1.0E-62
sp|Q6P2Y3|DNJC2_XENTR DnaJ homolog subfamily C member 2 OS=Xenopus tropicalis GN=dnajc2 PE=2 SV=2 93 309 1.0E-61
sp|P32527|ZUO1_YEAST Zuotin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZUO1 PE=1 SV=1 6 310 3.0E-61
sp|Q0II91|DJC21_BOVIN DnaJ homolog subfamily C member 21 OS=Bos taurus GN=DNAJC21 PE=2 SV=2 103 353 3.0E-11
sp|Q6PGY5|DJC21_DANRE DnaJ homolog subfamily C member 21 OS=Danio rerio GN=dnajc21 PE=2 SV=1 103 324 5.0E-11
sp|Q5F1R6|DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens GN=DNAJC21 PE=1 SV=2 103 324 7.0E-11
sp|P53863|JJJ1_YEAST J protein JJJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ1 PE=1 SV=1 103 355 2.0E-08
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 99 216 1.0E-07
sp|Q9HGM9|DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.02c PE=3 SV=1 31 182 2.0E-07
sp|Q8VXV4|DNJ16_ARATH Chaperone protein dnaJ 16 OS=Arabidopsis thaliana GN=ATJ16 PE=2 SV=1 100 214 1.0E-06
sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 100 181 4.0E-06
sp|B2FMY6|DNAJ_STRMK Chaperone protein DnaJ OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaJ PE=3 SV=1 98 215 4.0E-06
sp|A9KKT9|DNAJ_CLOPH Chaperone protein DnaJ OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaJ PE=3 SV=1 100 232 4.0E-06
sp|Q6L0S6|DNAJ_PICTO Chaperone protein DnaJ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaJ PE=3 SV=1 102 218 6.0E-06
sp|B2RLJ0|DNAJ_PORG3 Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaJ PE=3 SV=1 100 181 6.0E-06
sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 100 181 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|117590
MATVAPVLPADYAPPTASTSRLTPASHRTLLPIGPAYLNHLKLSLKHANDFEALDSHLKDELDKKRALEADGANG
EDDLGVGDEPEADEVLDLDPKEWKKHDYYAVLGLSHLRFRATQDQIKIAHRKKVLKHHPDKKVSSATPPTNALQF
SGINTNDDAFFKCIQKAHEVLSHPEKRRQFDSVDPTFIEWEEDLPSTSVKNKKDLKFFTTFGPIFEHYSRFSRVQ
PVPPLGAVDATKAEVEGFYDFWYNFDSWRSFEWWDKEVNEGSDNRDDKRYTEKKNKSERARRKKEDTAKLRGLVD
LTLGLDPRIKRIKQEEKEAREAKKRGAAGGPPKKTKQQEEEEKKKLEEEARKKEEEEKAARAEAKKAKAAAANAA
KKARRAARAAEGET*
Coding >AgabiH97|117590
ATGGCCACCGTTGCCCCCGTCCTCCCCGCCGACTATGCTCCTCCGACAGCGTCGACCTCGCGACTCACTCCGGCG
AGCCACAGGACCCTGCTGCCCATAGGACCAGCTTATCTCAACCATCTCAAACTTTCTCTCAAACATGCGAACGAT
TTCGAGGCTCTAGACAGTCATCTCAAAGATGAACTTGATAAAAAGCGCGCTTTGGAGGCGGATGGTGCTAATGGC
GAAGACGATTTGGGTGTTGGCGATGAGCCAGAGGCTGATGAGGTGCTTGATCTCGATCCTAAAGAATGGAAGAAA
CACGATTATTATGCTGTTCTTGGTCTTTCGCATCTGCGTTTCCGCGCAACTCAAGACCAGATCAAGATCGCTCAT
CGCAAAAAGGTTCTCAAACACCACCCCGATAAAAAGGTGTCCTCCGCTACACCTCCCACCAATGCCTTGCAATTT
TCTGGCATCAATACCAACGATGATGCGTTCTTCAAGTGTATTCAAAAAGCACACGAGGTCTTGAGTCATCCTGAA
AAACGCCGTCAATTCGATTCGGTGGATCCTACTTTTATTGAATGGGAAGAAGATCTCCCGTCGACATCTGTCAAG
AACAAAAAAGATCTCAAGTTTTTTACCACTTTTGGCCCGATTTTCGAGCATTATTCGAGATTCTCTCGTGTTCAG
CCGGTACCGCCTCTCGGTGCTGTAGATGCTACGAAAGCAGAAGTCGAAGGGTTCTACGATTTTTGGTACAACTTT
GATAGCTGGAGGAGTTTTGAGTGGTGGGACAAGGAGGTCAATGAAGGTAGTGATAACCGTGATGACAAACGTTAT
ACGGAAAAGAAAAACAAGTCGGAGCGTGCGCGTAGAAAGAAGGAAGATACTGCCAAGCTTCGCGGTCTGGTAGAC
CTAACTTTGGGTCTTGACCCCCGTATCAAACGCATCAAGCAAGAGGAGAAGGAAGCTAGAGAGGCAAAGAAGCGT
GGTGCAGCAGGCGGTCCTCCGAAAAAGACGAAGCAGCAGGAAGAGGAAGAAAAGAAGAAGCTCGAAGAAGAAGCT
CGCAAGAAAGAAGAGGAAGAAAAGGCTGCTCGTGCAGAGGCGAAAAAAGCCAAGGCTGCGGCTGCAAATGCTGCG
AAAAAGGCGAGGAGGGCTGCCCGGGCTGCAGAGGGCGAAACTTAG
Transcript >AgabiH97|117590
ATGGCCACCGTTGCCCCCGTCCTCCCCGCCGACTATGCTCCTCCGACAGCGTCGACCTCGCGACTCACTCCGGCG
AGCCACAGGACCCTGCTGCCCATAGGACCAGCTTATCTCAACCATCTCAAACTTTCTCTCAAACATGCGAACGAT
TTCGAGGCTCTAGACAGTCATCTCAAAGATGAACTTGATAAAAAGCGCGCTTTGGAGGCGGATGGTGCTAATGGC
GAAGACGATTTGGGTGTTGGCGATGAGCCAGAGGCTGATGAGGTGCTTGATCTCGATCCTAAAGAATGGAAGAAA
CACGATTATTATGCTGTTCTTGGTCTTTCGCATCTGCGTTTCCGCGCAACTCAAGACCAGATCAAGATCGCTCAT
CGCAAAAAGGTTCTCAAACACCACCCCGATAAAAAGGTGTCCTCCGCTACACCTCCCACCAATGCCTTGCAATTT
TCTGGCATCAATACCAACGATGATGCGTTCTTCAAGTGTATTCAAAAAGCACACGAGGTCTTGAGTCATCCTGAA
AAACGCCGTCAATTCGATTCGGTGGATCCTACTTTTATTGAATGGGAAGAAGATCTCCCGTCGACATCTGTCAAG
AACAAAAAAGATCTCAAGTTTTTTACCACTTTTGGCCCGATTTTCGAGCATTATTCGAGATTCTCTCGTGTTCAG
CCGGTACCGCCTCTCGGTGCTGTAGATGCTACGAAAGCAGAAGTCGAAGGGTTCTACGATTTTTGGTACAACTTT
GATAGCTGGAGGAGTTTTGAGTGGTGGGACAAGGAGGTCAATGAAGGTAGTGATAACCGTGATGACAAACGTTAT
ACGGAAAAGAAAAACAAGTCGGAGCGTGCGCGTAGAAAGAAGGAAGATACTGCCAAGCTTCGCGGTCTGGTAGAC
CTAACTTTGGGTCTTGACCCCCGTATCAAACGCATCAAGCAAGAGGAGAAGGAAGCTAGAGAGGCAAAGAAGCGT
GGTGCAGCAGGCGGTCCTCCGAAAAAGACGAAGCAGCAGGAAGAGGAAGAAAAGAAGAAGCTCGAAGAAGAAGCT
CGCAAGAAAGAAGAGGAAGAAAAGGCTGCTCGTGCAGAGGCGAAAAAAGCCAAGGCTGCGGCTGCAAATGCTGCG
AAAAAGGCGAGGAGGGCTGCCCGGGCTGCAGAGGGCGAAACTTAG
Gene >AgabiH97|117590
ATGGCCACCGTTGCCCCCGTCCTCCCCGCCGACTATGCTCCTCCGACAGCGTCGACCTCGCGACTCACTCGTGCG
TAAACAGTCTCTGGATTCGCCGTGTTTTTTTTTTCTGAATTTCTGTTTAGCGGCGAGCCACAGGACCCTGCTGCC
CATAGGACCAGCTTATCTCAACCATCTCAAACTTTCTCTCAAACATGCGAACGATTTCGAGGCTCTAGACAGTCA
TCTCAAAGATGAACTTGATAAAAAGCGCGCTTTGGAGGCGGATGGTGCTAATGGCGAAGACGATTTGGGTGTTGG
CGATGAGCCAGAGGCTGATGAGGTGCTTGATCTCGATCCTAAAGAATGGAAGGTGCGTCGAGTTATTATCTTTCA
TAAATTCATTCTTGATAGTGTTTTTTAGAAACACGATTATTATGCTGTTCTTGGTCTTTCGCATCTGCGTTTCCG
CGCAACTCAAGACCAGATCAAGATCGCTCGTAATGTCTTTTTTTTCTTGTTACATCAGACGACCAATTAATCAAG
ATATGAAGATCGCAAAAAGGTTCTCAAACACCACCCCGATAAAAAGGTGTCCTCCGCTACACCTCCCACCAATGC
CTTGCAATTTTCTGGCATCAATACCAACGATGATGCGTTCTTCAAGTGTATTCAAAAAGCACACGAGGTCTTGAG
TCATCCTGAAAAACGCCGTCAATTCGATTCGGTGGATCCTACTTTTATTGAATGGGAAGAAGATCTCCCGTCGAC
ATCTGTCAAGGTGAGCAATTTCGCGAGATCTTTTTGATTTTAATTTTTTACCAATGACAATAGAACAAAAAAGAT
CTCAAGTTTTTTACCACTTTTGGCCCGATTTTCGAGCATTATTCGAGATTCTCTCGTGTTCAGCCGGTACCGCCT
CTCGGTGCTGTAGATGCTACGAAAGCAGAAGTCGAAGGGTTCTACGATTTTTGGTACAACTTTGATAGCTGGAGG
AGTTTTGAGTGGTGGGACAAGGAGGTCAATGAAGGTAGTGATAAGTAAGATGTCTGATGATTACTCGTGGTCTCT
TCTTCACTAACCAAATTTGATTGTAGCCGTGATGACAAACGTTATACGGAAAAGAAAAACAAGTCGGAGCGTGCG
CGTAGAAAGAAGGAAGATACTGCCAAGCTTCGCGGTCTGGTAGACCTAACTTTGGGTCTTGACCCCCGTATCAAA
CGCATCAAGCAAGAGGAGAAGGAAGCTAGAGAGGCAAAGAAGCGTGGTGCAGCAGGCGGTCCTCCGAAAAAGACG
AAGCAGCAGGAAGAGGAAGAAAAGAAGAAGCTCGAAGAAGAAGCTCGCAAGAAAGAAGAGGAAGAAAAGGTTGGT
GAAACGAACGACTTTGAGTGTTTTATACTGAAATGTTCTTGTCAGGCTGCTCGTGCAGAGGCGAAAAAAGCCAAG
GCTGCGGCTGCAAATGCTGCGAAAAAGGCGAGGAGGGCTGCCCGGGCTGCAGAGGGCGAAACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail