© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|117390 |
| Gene name | |
| Location | scaffold_9:1009548..1010336 |
| Strand | - |
| Gene length (bp) | 788 |
| Transcript length (bp) | 732 |
| Coding sequence length (bp) | 732 |
| Protein length (aa) | 244 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 24 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 53.66 | 29.80 | 77.51 |
| Initials | Initials knots | 105.39 | 62.25 | 148.53 |
| Pileal_Stipeal_center | Stage I stipe center | 66.27 | 37.29 | 95.26 |
| Pileal_Stipeal_shell | Stage I stipe shell | 215.49 | 124.70 | 306.27 |
| DIF_stipe_center | Stage II stipe center | 65.21 | 37.13 | 93.30 |
| DIF_stipe_shell | Stage II stipe shell | 52.04 | 28.88 | 75.20 |
| DIF_stipe_skin | Stage II stipe skin | 68.26 | 38.08 | 98.43 |
| DIF_cap_skin | Stage II cap skin | 122.88 | 73.00 | 172.77 |
| DIF_cap_tissue | Stage II cap tissue | 196.78 | 117.68 | 275.88 |
| DIF_gill_tissue | Stage II gill tissue | 242.06 | 145.12 | 339.01 |
| YFB_stipe_center | Young fruiting body stipe center | 41.92 | 21.72 | 62.11 |
| YFB_stipe_shell | Young fruiting body stipe shell | 48.65 | 26.72 | 70.58 |
| YFB_stipe_skin | Young fruiting body stipe skin | 53.10 | 29.28 | 76.92 |
| YFB_cap_skin | Young fruiting body cap skin | 78.31 | 45.43 | 111.19 |
| YFB_cap_tissue | Young fruiting body cap tissue | 139.96 | 82.78 | 197.15 |
| YFB_gill_tissue | Young fruiting body gill tissue | 82.18 | 45.00 | 119.36 |
| YFB_veil | Young fruiting body veil | 119.39 | 68.83 | 169.94 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.000613 | yes |
| Casing | YFB_stipe_center | 0.559940 | no |
| Casing | YFB_stipe_shell | 0.854305 | no |
| Casing | YFB_stipe_skin | 0.986319 | no |
| Casing | YFB_cap_skin | 0.243427 | no |
| Casing | YFB_cap_tissue | 0.000613 | yes |
| Casing | YFB_gill_tissue | 0.192656 | no |
| Casing | YFB_veil | 0.003765 | yes |
| Casing | Initials | 0.013782 | yes |
| Casing | Pileal_Stipeal_center | 0.612840 | no |
| Casing | Pileal_Stipeal_shell | 0.000613 | yes |
| Casing | DIF_stipe_center | 0.638493 | no |
| Casing | DIF_stipe_shell | 0.960039 | no |
| Casing | DIF_stipe_skin | 0.550865 | no |
| Casing | DIF_cap_skin | 0.002525 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.032978 | yes |
| DIF_gill_tissue | YFB_gill_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_veil | 0.005671 | yes |
| YFB_stipe_center | YFB_stipe_shell | 0.768086 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.580413 | no |
| YFB_stipe_center | YFB_cap_skin | 0.046327 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.025205 | yes |
| YFB_stipe_center | YFB_veil | 0.000613 | yes |
| YFB_stipe_shell | YFB_stipe_skin | 0.872694 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.110389 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.079123 | no |
| YFB_stipe_shell | YFB_veil | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_skin | 0.227254 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.175292 | no |
| YFB_stipe_skin | YFB_veil | 0.001625 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.029890 | yes |
| YFB_cap_skin | YFB_gill_tissue | 0.930692 | no |
| YFB_cap_skin | YFB_veil | 0.160388 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.054375 | no |
| YFB_cap_tissue | YFB_veil | 0.707171 | no |
| YFB_gill_tissue | YFB_veil | 0.250478 | no |
| Initials | DIF_gill_tissue | 0.000613 | yes |
| Initials | YFB_stipe_center | 0.000613 | yes |
| Initials | YFB_stipe_shell | 0.004160 | yes |
| Initials | YFB_stipe_skin | 0.010728 | yes |
| Initials | YFB_cap_skin | 0.363873 | no |
| Initials | YFB_cap_tissue | 0.382372 | no |
| Initials | YFB_gill_tissue | 0.503573 | no |
| Initials | YFB_veil | 0.782786 | no |
| Initials | Pileal_Stipeal_center | 0.117477 | no |
| Initials | Pileal_Stipeal_shell | 0.008457 | yes |
| Initials | DIF_stipe_center | 0.092841 | no |
| Initials | DIF_stipe_shell | 0.007782 | yes |
| Initials | DIF_stipe_skin | 0.150844 | no |
| Initials | DIF_cap_skin | 0.710363 | no |
| Initials | DIF_cap_tissue | 0.014081 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_stipe_center | 0.173970 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.395048 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.591496 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.701610 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.004548 | yes |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.606747 | no |
| Pileal_Stipeal_center | YFB_veil | 0.037140 | yes |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_stipe_center | 0.978854 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.548548 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.962135 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.024946 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.795974 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.140144 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_veil | 0.030372 | yes |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.039165 | yes |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.850186 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_stipe_center | 0.184962 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.412952 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.610839 | no |
| DIF_stipe_center | YFB_cap_skin | 0.648127 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.002951 | yes |
| DIF_stipe_center | YFB_gill_tissue | 0.554850 | no |
| DIF_stipe_center | YFB_veil | 0.026461 | yes |
| DIF_stipe_center | DIF_stipe_shell | 0.568904 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.936748 | no |
| DIF_stipe_center | DIF_cap_skin | 0.019987 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_stipe_center | 0.631374 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.909379 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.973674 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.197355 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.148512 | no |
| DIF_stipe_shell | YFB_veil | 0.001140 | yes |
| DIF_stipe_shell | DIF_stipe_skin | 0.486243 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.143064 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.339840 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.525192 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.767760 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.007092 | yes |
| DIF_stipe_skin | YFB_gill_tissue | 0.674330 | no |
| DIF_stipe_skin | YFB_veil | 0.056170 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.041824 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.000613 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.007782 | yes |
| DIF_cap_skin | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.001140 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.001140 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.115041 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.763457 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.195445 | no |
| DIF_cap_skin | YFB_veil | 0.959900 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.086585 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.554635 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_tissue | 0.252288 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.000613 | yes |
| DIF_cap_tissue | YFB_veil | 0.065465 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|117390 MNTYFKSLIAAALVFATFAPVTASPVARHVGRQEGSIPVGPQSTTLSSLNGTQEMPSSAVLEPTASYSTEMPSSA TAEPTSISSVSGNQSVPSASSSISETMTFFPPCYMPTPSTDTSTNGSPTTFEGGSSAPTGNPGISTSTLESVTLL PTTTMPSPTEIPDASSGIPESATLPATVMSPPTEVPGGNTGSSESATLSIPSSPTAVSGVSASSPGSMTVDTAAT ATETPTPATNGNTTSGTA* |
| Coding | >AgabiH97|117390 ATGAACACGTACTTCAAATCTCTGATTGCTGCCGCGCTCGTTTTCGCCACATTCGCTCCAGTAACTGCCAGCCCT GTGGCAAGGCATGTCGGACGACAGGAAGGTAGCATTCCCGTTGGCCCACAATCGACCACCCTCAGTTCCCTGAAC GGTACCCAGGAGATGCCGTCTTCTGCTGTCTTGGAACCGACAGCTTCCTATAGTACCGAAATGCCATCTTCTGCT ACTGCTGAGCCGACATCAATCAGCTCAGTCAGTGGCAACCAAAGCGTTCCGTCCGCGTCATCTTCAATCTCAGAA ACGATGACTTTCTTCCCGCCGTGCTACATGCCCACCCCTTCGACGGACACATCGACAAATGGAAGTCCCACAACA TTTGAGGGAGGTTCTTCAGCTCCTACGGGTAATCCAGGAATTAGCACTAGTACTCTTGAATCAGTGACTCTGCTG CCAACGACCACAATGCCGTCCCCCACAGAAATCCCGGATGCTAGCTCTGGCATTCCTGAGTCAGCGACTCTGCCA GCGACTGTAATGTCGCCCCCCACTGAAGTTCCTGGAGGCAACACTGGCAGTTCCGAGTCAGCGACTCTGAGCATC CCGTCTTCCCCCACAGCCGTTTCCGGAGTTAGCGCTAGCAGTCCTGGATCAATGACCGTGGACACTGCGGCTACT GCGACGGAGACCCCTACACCCGCTACAAATGGTAATACTACAAGCGGCACCGCTTGA |
| Transcript | >AgabiH97|117390 ATGAACACGTACTTCAAATCTCTGATTGCTGCCGCGCTCGTTTTCGCCACATTCGCTCCAGTAACTGCCAGCCCT GTGGCAAGGCATGTCGGACGACAGGAAGGTAGCATTCCCGTTGGCCCACAATCGACCACCCTCAGTTCCCTGAAC GGTACCCAGGAGATGCCGTCTTCTGCTGTCTTGGAACCGACAGCTTCCTATAGTACCGAAATGCCATCTTCTGCT ACTGCTGAGCCGACATCAATCAGCTCAGTCAGTGGCAACCAAAGCGTTCCGTCCGCGTCATCTTCAATCTCAGAA ACGATGACTTTCTTCCCGCCGTGCTACATGCCCACCCCTTCGACGGACACATCGACAAATGGAAGTCCCACAACA TTTGAGGGAGGTTCTTCAGCTCCTACGGGTAATCCAGGAATTAGCACTAGTACTCTTGAATCAGTGACTCTGCTG CCAACGACCACAATGCCGTCCCCCACAGAAATCCCGGATGCTAGCTCTGGCATTCCTGAGTCAGCGACTCTGCCA GCGACTGTAATGTCGCCCCCCACTGAAGTTCCTGGAGGCAACACTGGCAGTTCCGAGTCAGCGACTCTGAGCATC CCGTCTTCCCCCACAGCCGTTTCCGGAGTTAGCGCTAGCAGTCCTGGATCAATGACCGTGGACACTGCGGCTACT GCGACGGAGACCCCTACACCCGCTACAAATGGTAATACTACAAGCGGCACCGCTTGA |
| Gene | >AgabiH97|117390 ATGAACACGTACTTCAAATCTCTGATTGCTGCCGCGCTCGTTTTCGCCACATTCGCTCCAGTAACTGCCAGCCCT GTGGCAAGGGTAGGTCAACCAGTCCTCTCAGAGTCATAAACTCTCTTACTCACTCTCTTCCTCAGCATGTCGGAC GACAGGAAGGTAGCATTCCCGTTGGCCCACAATCGACCACCCTCAGTTCCCTGAACGGTACCCAGGAGATGCCGT CTTCTGCTGTCTTGGAACCGACAGCTTCCTATAGTACCGAAATGCCATCTTCTGCTACTGCTGAGCCGACATCAA TCAGCTCAGTCAGTGGCAACCAAAGCGTTCCGTCCGCGTCATCTTCAATCTCAGAAACGATGACTTTCTTCCCGC CGTGCTACATGCCCACCCCTTCGACGGACACATCGACAAATGGAAGTCCCACAACATTTGAGGGAGGTTCTTCAG CTCCTACGGGTAATCCAGGAATTAGCACTAGTACTCTTGAATCAGTGACTCTGCTGCCAACGACCACAATGCCGT CCCCCACAGAAATCCCGGATGCTAGCTCTGGCATTCCTGAGTCAGCGACTCTGCCAGCGACTGTAATGTCGCCCC CCACTGAAGTTCCTGGAGGCAACACTGGCAGTTCCGAGTCAGCGACTCTGAGCATCCCGTCTTCCCCCACAGCCG TTTCCGGAGTTAGCGCTAGCAGTCCTGGATCAATGACCGTGGACACTGCGGCTACTGCGACGGAGACCCCTACAC CCGCTACAAATGGTAATACTACAAGCGGCACCGCTTGA |