Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|117390
Gene name
Locationscaffold_9:1009548..1010336
Strand-
Gene length (bp)788
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 53.66 29.80 77.51
Initials Initials knots 105.39 62.25 148.53
Pileal_Stipeal_center Stage I stipe center 66.27 37.29 95.26
Pileal_Stipeal_shell Stage I stipe shell 215.49 124.70 306.27
DIF_stipe_center Stage II stipe center 65.21 37.13 93.30
DIF_stipe_shell Stage II stipe shell 52.04 28.88 75.20
DIF_stipe_skin Stage II stipe skin 68.26 38.08 98.43
DIF_cap_skin Stage II cap skin 122.88 73.00 172.77
DIF_cap_tissue Stage II cap tissue 196.78 117.68 275.88
DIF_gill_tissue Stage II gill tissue 242.06 145.12 339.01
YFB_stipe_center Young fruiting body stipe center 41.92 21.72 62.11
YFB_stipe_shell Young fruiting body stipe shell 48.65 26.72 70.58
YFB_stipe_skin Young fruiting body stipe skin 53.10 29.28 76.92
YFB_cap_skin Young fruiting body cap skin 78.31 45.43 111.19
YFB_cap_tissue Young fruiting body cap tissue 139.96 82.78 197.15
YFB_gill_tissue Young fruiting body gill tissue 82.18 45.00 119.36
YFB_veil Young fruiting body veil 119.39 68.83 169.94

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.559940 no
Casing YFB_stipe_shell 0.854305 no
Casing YFB_stipe_skin 0.986319 no
Casing YFB_cap_skin 0.243427 no
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.192656 no
Casing YFB_veil 0.003765 yes
Casing Initials 0.013782 yes
Casing Pileal_Stipeal_center 0.612840 no
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.638493 no
Casing DIF_stipe_shell 0.960039 no
Casing DIF_stipe_skin 0.550865 no
Casing DIF_cap_skin 0.002525 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.032978 yes
DIF_gill_tissue YFB_gill_tissue 0.000613 yes
DIF_gill_tissue YFB_veil 0.005671 yes
YFB_stipe_center YFB_stipe_shell 0.768086 no
YFB_stipe_center YFB_stipe_skin 0.580413 no
YFB_stipe_center YFB_cap_skin 0.046327 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.025205 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.872694 no
YFB_stipe_shell YFB_cap_skin 0.110389 no
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.079123 no
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.227254 no
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.175292 no
YFB_stipe_skin YFB_veil 0.001625 yes
YFB_cap_skin YFB_cap_tissue 0.029890 yes
YFB_cap_skin YFB_gill_tissue 0.930692 no
YFB_cap_skin YFB_veil 0.160388 no
YFB_cap_tissue YFB_gill_tissue 0.054375 no
YFB_cap_tissue YFB_veil 0.707171 no
YFB_gill_tissue YFB_veil 0.250478 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.004160 yes
Initials YFB_stipe_skin 0.010728 yes
Initials YFB_cap_skin 0.363873 no
Initials YFB_cap_tissue 0.382372 no
Initials YFB_gill_tissue 0.503573 no
Initials YFB_veil 0.782786 no
Initials Pileal_Stipeal_center 0.117477 no
Initials Pileal_Stipeal_shell 0.008457 yes
Initials DIF_stipe_center 0.092841 no
Initials DIF_stipe_shell 0.007782 yes
Initials DIF_stipe_skin 0.150844 no
Initials DIF_cap_skin 0.710363 no
Initials DIF_cap_tissue 0.014081 yes
Pileal_Stipeal_center DIF_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_stipe_center 0.173970 no
Pileal_Stipeal_center YFB_stipe_shell 0.395048 no
Pileal_Stipeal_center YFB_stipe_skin 0.591496 no
Pileal_Stipeal_center YFB_cap_skin 0.701610 no
Pileal_Stipeal_center YFB_cap_tissue 0.004548 yes
Pileal_Stipeal_center YFB_gill_tissue 0.606747 no
Pileal_Stipeal_center YFB_veil 0.037140 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.978854 no
Pileal_Stipeal_center DIF_stipe_shell 0.548548 no
Pileal_Stipeal_center DIF_stipe_skin 0.962135 no
Pileal_Stipeal_center DIF_cap_skin 0.024946 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.795974 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.140144 no
Pileal_Stipeal_shell YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_veil 0.030372 yes
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.039165 yes
Pileal_Stipeal_shell DIF_cap_tissue 0.850186 no
DIF_stipe_center DIF_gill_tissue 0.000613 yes
DIF_stipe_center YFB_stipe_center 0.184962 no
DIF_stipe_center YFB_stipe_shell 0.412952 no
DIF_stipe_center YFB_stipe_skin 0.610839 no
DIF_stipe_center YFB_cap_skin 0.648127 no
DIF_stipe_center YFB_cap_tissue 0.002951 yes
DIF_stipe_center YFB_gill_tissue 0.554850 no
DIF_stipe_center YFB_veil 0.026461 yes
DIF_stipe_center DIF_stipe_shell 0.568904 no
DIF_stipe_center DIF_stipe_skin 0.936748 no
DIF_stipe_center DIF_cap_skin 0.019987 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.631374 no
DIF_stipe_shell YFB_stipe_shell 0.909379 no
DIF_stipe_shell YFB_stipe_skin 0.973674 no
DIF_stipe_shell YFB_cap_skin 0.197355 no
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.148512 no
DIF_stipe_shell YFB_veil 0.001140 yes
DIF_stipe_shell DIF_stipe_skin 0.486243 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_stipe_center 0.143064 no
DIF_stipe_skin YFB_stipe_shell 0.339840 no
DIF_stipe_skin YFB_stipe_skin 0.525192 no
DIF_stipe_skin YFB_cap_skin 0.767760 no
DIF_stipe_skin YFB_cap_tissue 0.007092 yes
DIF_stipe_skin YFB_gill_tissue 0.674330 no
DIF_stipe_skin YFB_veil 0.056170 no
DIF_stipe_skin DIF_cap_skin 0.041824 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.007782 yes
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.001140 yes
DIF_cap_skin YFB_stipe_skin 0.001140 yes
DIF_cap_skin YFB_cap_skin 0.115041 no
DIF_cap_skin YFB_cap_tissue 0.763457 no
DIF_cap_skin YFB_gill_tissue 0.195445 no
DIF_cap_skin YFB_veil 0.959900 no
DIF_cap_skin DIF_cap_tissue 0.086585 no
DIF_cap_tissue DIF_gill_tissue 0.554635 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.000613 yes
DIF_cap_tissue YFB_cap_tissue 0.252288 no
DIF_cap_tissue YFB_gill_tissue 0.000613 yes
DIF_cap_tissue YFB_veil 0.065465 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|117390
MNTYFKSLIAAALVFATFAPVTASPVARHVGRQEGSIPVGPQSTTLSSLNGTQEMPSSAVLEPTASYSTEMPSSA
TAEPTSISSVSGNQSVPSASSSISETMTFFPPCYMPTPSTDTSTNGSPTTFEGGSSAPTGNPGISTSTLESVTLL
PTTTMPSPTEIPDASSGIPESATLPATVMSPPTEVPGGNTGSSESATLSIPSSPTAVSGVSASSPGSMTVDTAAT
ATETPTPATNGNTTSGTA*
Coding >AgabiH97|117390
ATGAACACGTACTTCAAATCTCTGATTGCTGCCGCGCTCGTTTTCGCCACATTCGCTCCAGTAACTGCCAGCCCT
GTGGCAAGGCATGTCGGACGACAGGAAGGTAGCATTCCCGTTGGCCCACAATCGACCACCCTCAGTTCCCTGAAC
GGTACCCAGGAGATGCCGTCTTCTGCTGTCTTGGAACCGACAGCTTCCTATAGTACCGAAATGCCATCTTCTGCT
ACTGCTGAGCCGACATCAATCAGCTCAGTCAGTGGCAACCAAAGCGTTCCGTCCGCGTCATCTTCAATCTCAGAA
ACGATGACTTTCTTCCCGCCGTGCTACATGCCCACCCCTTCGACGGACACATCGACAAATGGAAGTCCCACAACA
TTTGAGGGAGGTTCTTCAGCTCCTACGGGTAATCCAGGAATTAGCACTAGTACTCTTGAATCAGTGACTCTGCTG
CCAACGACCACAATGCCGTCCCCCACAGAAATCCCGGATGCTAGCTCTGGCATTCCTGAGTCAGCGACTCTGCCA
GCGACTGTAATGTCGCCCCCCACTGAAGTTCCTGGAGGCAACACTGGCAGTTCCGAGTCAGCGACTCTGAGCATC
CCGTCTTCCCCCACAGCCGTTTCCGGAGTTAGCGCTAGCAGTCCTGGATCAATGACCGTGGACACTGCGGCTACT
GCGACGGAGACCCCTACACCCGCTACAAATGGTAATACTACAAGCGGCACCGCTTGA
Transcript >AgabiH97|117390
ATGAACACGTACTTCAAATCTCTGATTGCTGCCGCGCTCGTTTTCGCCACATTCGCTCCAGTAACTGCCAGCCCT
GTGGCAAGGCATGTCGGACGACAGGAAGGTAGCATTCCCGTTGGCCCACAATCGACCACCCTCAGTTCCCTGAAC
GGTACCCAGGAGATGCCGTCTTCTGCTGTCTTGGAACCGACAGCTTCCTATAGTACCGAAATGCCATCTTCTGCT
ACTGCTGAGCCGACATCAATCAGCTCAGTCAGTGGCAACCAAAGCGTTCCGTCCGCGTCATCTTCAATCTCAGAA
ACGATGACTTTCTTCCCGCCGTGCTACATGCCCACCCCTTCGACGGACACATCGACAAATGGAAGTCCCACAACA
TTTGAGGGAGGTTCTTCAGCTCCTACGGGTAATCCAGGAATTAGCACTAGTACTCTTGAATCAGTGACTCTGCTG
CCAACGACCACAATGCCGTCCCCCACAGAAATCCCGGATGCTAGCTCTGGCATTCCTGAGTCAGCGACTCTGCCA
GCGACTGTAATGTCGCCCCCCACTGAAGTTCCTGGAGGCAACACTGGCAGTTCCGAGTCAGCGACTCTGAGCATC
CCGTCTTCCCCCACAGCCGTTTCCGGAGTTAGCGCTAGCAGTCCTGGATCAATGACCGTGGACACTGCGGCTACT
GCGACGGAGACCCCTACACCCGCTACAAATGGTAATACTACAAGCGGCACCGCTTGA
Gene >AgabiH97|117390
ATGAACACGTACTTCAAATCTCTGATTGCTGCCGCGCTCGTTTTCGCCACATTCGCTCCAGTAACTGCCAGCCCT
GTGGCAAGGGTAGGTCAACCAGTCCTCTCAGAGTCATAAACTCTCTTACTCACTCTCTTCCTCAGCATGTCGGAC
GACAGGAAGGTAGCATTCCCGTTGGCCCACAATCGACCACCCTCAGTTCCCTGAACGGTACCCAGGAGATGCCGT
CTTCTGCTGTCTTGGAACCGACAGCTTCCTATAGTACCGAAATGCCATCTTCTGCTACTGCTGAGCCGACATCAA
TCAGCTCAGTCAGTGGCAACCAAAGCGTTCCGTCCGCGTCATCTTCAATCTCAGAAACGATGACTTTCTTCCCGC
CGTGCTACATGCCCACCCCTTCGACGGACACATCGACAAATGGAAGTCCCACAACATTTGAGGGAGGTTCTTCAG
CTCCTACGGGTAATCCAGGAATTAGCACTAGTACTCTTGAATCAGTGACTCTGCTGCCAACGACCACAATGCCGT
CCCCCACAGAAATCCCGGATGCTAGCTCTGGCATTCCTGAGTCAGCGACTCTGCCAGCGACTGTAATGTCGCCCC
CCACTGAAGTTCCTGGAGGCAACACTGGCAGTTCCGAGTCAGCGACTCTGAGCATCCCGTCTTCCCCCACAGCCG
TTTCCGGAGTTAGCGCTAGCAGTCCTGGATCAATGACCGTGGACACTGCGGCTACTGCGACGGAGACCCCTACAC
CCGCTACAAATGGTAATACTACAAGCGGCACCGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail