Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|117280
Gene name
Locationscaffold_9:980679..982005
Strand+
Gene length (bp)1326
Transcript length (bp)1047
Coding sequence length (bp)1047
Protein length (aa) 349

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01048 PNP_UDP_1 Phosphorylase superfamily 2.0E-39 68 343

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTG1|PNPH_SCHPO Putative purine nucleoside phosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1805.16c PE=3 SV=1 50 347 2.0E-75
sp|P55859|PNPH_BOVIN Purine nucleoside phosphorylase OS=Bos taurus GN=PNP PE=1 SV=3 65 340 2.0E-69
sp|P00491|PNPH_HUMAN Purine nucleoside phosphorylase OS=Homo sapiens GN=PNP PE=1 SV=2 51 340 3.0E-69
sp|Q05788|PNPH_YEAST Purine nucleoside phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PNP1 PE=1 SV=1 49 344 8.0E-69
sp|P85973|PNPH_RAT Purine nucleoside phosphorylase OS=Rattus norvegicus GN=Pnp PE=1 SV=1 52 345 1.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTG1|PNPH_SCHPO Putative purine nucleoside phosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1805.16c PE=3 SV=1 50 347 2.0E-75
sp|P55859|PNPH_BOVIN Purine nucleoside phosphorylase OS=Bos taurus GN=PNP PE=1 SV=3 65 340 2.0E-69
sp|P00491|PNPH_HUMAN Purine nucleoside phosphorylase OS=Homo sapiens GN=PNP PE=1 SV=2 51 340 3.0E-69
sp|Q05788|PNPH_YEAST Purine nucleoside phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PNP1 PE=1 SV=1 49 344 8.0E-69
sp|P85973|PNPH_RAT Purine nucleoside phosphorylase OS=Rattus norvegicus GN=Pnp PE=1 SV=1 52 345 1.0E-68
sp|P23492|PNPH_MOUSE Purine nucleoside phosphorylase OS=Mus musculus GN=Pnp PE=1 SV=2 66 345 3.0E-68
sp|P46354|PUNA_BACSU Purine nucleoside phosphorylase 1 OS=Bacillus subtilis (strain 168) GN=punA PE=1 SV=1 45 309 1.0E-60
sp|P77834|PUNA_GEOSE Purine nucleoside phosphorylase 1 OS=Geobacillus stearothermophilus GN=punA PE=1 SV=1 46 289 3.0E-56
sp|P45563|XAPA_ECOLI Purine nucleoside phosphorylase 2 OS=Escherichia coli (strain K12) GN=xapA PE=1 SV=2 48 314 1.0E-46
sp|P46862|PUNA_MYCLE Purine nucleoside phosphorylase OS=Mycobacterium leprae (strain TN) GN=punA PE=3 SV=1 69 344 1.0E-39
sp|P9WP01|PUNA_MYCTU Purine nucleoside phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=punA PE=1 SV=1 69 344 7.0E-39
sp|P9WP00|PUNA_MYCTO Purine nucleoside phosphorylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=punA PE=3 SV=1 69 344 7.0E-39
sp|P0A539|PUNA_MYCBO Purine nucleoside phosphorylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=punA PE=3 SV=1 69 344 7.0E-39
sp|P81989|PUNA_CELSP Purine nucleoside phosphorylase OS=Cellulomonas sp. GN=punA PE=1 SV=1 71 305 8.0E-30
sp|Q8U2I1|PNPH_PYRFU Probable 6-oxopurine nucleoside phosphorylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0853 PE=1 SV=1 67 347 6.0E-19
sp|Q8U4Q8|MTAP_PYRFU S-methyl-5'-thioadenosine phosphorylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=mtnP PE=1 SV=1 67 344 9.0E-19
sp|Q9V2F1|MTAP_PYRAB S-methyl-5'-thioadenosine phosphorylase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=mntP PE=3 SV=1 67 344 2.0E-18
sp|O57865|MTAP_PYRHO S-methyl-5'-thioadenosine phosphorylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=mtnP PE=3 SV=2 67 344 3.0E-18
sp|Q2RKL6|PNPH_MOOTA Probable 6-oxopurine nucleoside phosphorylase OS=Moorella thermoacetica (strain ATCC 39073) GN=Moth_0705 PE=3 SV=1 68 344 3.0E-18
sp|Q5JJB8|PNPH_THEKO Probable 6-oxopurine nucleoside phosphorylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1482 PE=3 SV=1 67 347 8.0E-18
sp|F6RQL9|MTAP_MACMU S-methyl-5'-thioadenosine phosphorylase OS=Macaca mulatta GN=MTAP PE=3 SV=1 68 340 3.0E-15
sp|Q13126|MTAP_HUMAN S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens GN=MTAP PE=1 SV=2 68 340 3.0E-15
sp|Q7ZV22|MTAP_DANRE S-methyl-5'-thioadenosine phosphorylase OS=Danio rerio GN=mtap PE=2 SV=2 68 340 5.0E-15
sp|Q9CQ65|MTAP_MOUSE S-methyl-5'-thioadenosine phosphorylase OS=Mus musculus GN=Mtap PE=1 SV=1 68 340 7.0E-15
sp|Q8ZTB2|MTAP_PYRAE S-methyl-5'-thioadenosine phosphorylase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=mtnP PE=3 SV=1 67 304 4.0E-14
sp|O66839|PNPH_AQUAE Probable 6-oxopurine nucleoside phosphorylase OS=Aquifex aeolicus (strain VF5) GN=aq_568 PE=3 SV=1 69 347 7.0E-14
sp|Q291H4|MTAP_DROPS S-methyl-5'-thioadenosine phosphorylase OS=Drosophila pseudoobscura pseudoobscura GN=GA18442 PE=3 SV=1 68 330 1.0E-13
sp|B8E181|PNPH_DICTD Probable 6-oxopurine nucleoside phosphorylase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=Dtur_0928 PE=3 SV=1 147 288 1.0E-13
sp|Q5JEQ6|MTAP_THEKO S-methyl-5'-thioadenosine phosphorylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=mtnP PE=3 SV=1 67 291 2.0E-13
sp|Q74E52|MTAP_GEOSL S-methyl-5'-thioadenosine phosphorylase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mtnP PE=3 SV=1 69 348 9.0E-13
sp|A1RXU2|MTAP_THEPD S-methyl-5'-thioadenosine phosphorylase OS=Thermofilum pendens (strain Hrk 5) GN=mtnP PE=3 SV=1 108 291 2.0E-12
sp|Q9V813|MTAP_DROME S-methyl-5'-thioadenosine phosphorylase OS=Drosophila melanogaster GN=Mtap PE=2 SV=1 118 330 2.0E-12
sp|O27633|MTIP_METTH Probable S-methyl-5'-thioinosine phosphorylase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1596 PE=3 SV=1 144 304 2.0E-12
sp|Q297F5|PNPH_DROPS Purine nucleoside phosphorylase OS=Drosophila pseudoobscura pseudoobscura GN=GA16019 PE=3 SV=2 144 348 6.0E-12
sp|Q97W94|MTAP_SULSO S-methyl-5'-thioadenosine phosphorylase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=mtnP PE=1 SV=1 65 292 2.0E-11
sp|Q8TQX8|MTIP_METAC Probable S-methyl-5'-thioinosine phosphorylase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1409 PE=3 SV=1 150 311 2.0E-11
sp|Q8IMU4|PNPH_DROME Purine nucleoside phosphorylase OS=Drosophila melanogaster GN=CG31115 PE=3 SV=2 56 289 2.0E-11
sp|Q60367|MTIP_METJA Probable S-methyl-5'-thioinosine phosphorylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0060 PE=3 SV=1 144 288 3.0E-11
sp|Q87ZC3|MTIP_PSESM Probable S-methyl-5'-thioinosine phosphorylase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_3506 PE=3 SV=1 71 288 3.0E-11
sp|Q8TZB4|MTIP_METKA Probable S-methyl-5'-thioinosine phosphorylase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0021 PE=3 SV=1 147 288 3.0E-11
sp|Q2RXH9|MTAP_RHORT S-methyl-5'-thioadenosine phosphorylase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mtnP PE=3 SV=1 65 303 3.0E-11
sp|F6V515|MTAP_XENTR S-methyl-5'-thioadenosine phosphorylase OS=Xenopus tropicalis GN=mtap PE=3 SV=1 68 340 3.0E-11
sp|B5YKP5|MTIP_THEYD Probable S-methyl-5'-thioinosine phosphorylase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=THEYE_A0977 PE=3 SV=1 147 275 4.0E-11
sp|Q89VT5|MTAP_BRADU S-methyl-5'-thioadenosine phosphorylase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mtnP PE=3 SV=1 64 299 6.0E-11
sp|Q3MHF7|MTAP_BOVIN S-methyl-5'-thioadenosine phosphorylase OS=Bos taurus GN=MTAP PE=1 SV=1 68 340 7.0E-11
sp|A0RVQ7|MTAP_CENSY S-methyl-5'-thioadenosine phosphorylase OS=Cenarchaeum symbiosum (strain A) GN=mtnP PE=3 SV=1 110 344 1.0E-10
sp|Q9HL98|MTAP_THEAC S-methyl-5'-thioadenosine phosphorylase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=mtnP PE=3 SV=1 69 291 3.0E-10
sp|B1L719|PNPH_KORCO Probable 6-oxopurine nucleoside phosphorylase OS=Korarchaeum cryptofilum (strain OPF8) GN=Kcr_1502 PE=3 SV=1 68 288 5.0E-10
sp|Q9HZK1|MTIP_PSEAE S-methyl-5'-thioinosine phosphorylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3004 PE=1 SV=1 71 288 2.0E-09
sp|A9A3N5|MTAP_NITMS S-methyl-5'-thioadenosine phosphorylase OS=Nitrosopumilus maritimus (strain SCM1) GN=mtnP PE=3 SV=1 144 316 5.0E-09
sp|Q9PAZ2|MTIP_XYLFA Probable S-methyl-5'-thioinosine phosphorylase OS=Xylella fastidiosa (strain 9a5c) GN=XF_2353 PE=3 SV=1 144 288 5.0E-09
sp|Q87BR7|MTIP_XYLFT Probable S-methyl-5'-thioinosine phosphorylase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mtnP PE=3 SV=1 144 288 6.0E-09
sp|Q16MW6|MTAP_AEDAE S-methyl-5'-thioadenosine phosphorylase OS=Aedes aegypti GN=AAEL012172 PE=3 SV=1 144 288 2.0E-08
sp|F6X2V8|MTAP_CIOIN S-methyl-5'-thioadenosine phosphorylase OS=Ciona intestinalis PE=3 SV=1 63 302 2.0E-08
sp|Q7Q9N9|MTAP_ANOGA S-methyl-5'-thioadenosine phosphorylase OS=Anopheles gambiae GN=AGAP005129 PE=3 SV=4 64 304 2.0E-08
sp|Q3J5E8|MTAP_RHOS4 S-methyl-5'-thioadenosine phosphorylase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mtnP PE=3 SV=1 69 299 2.0E-08
sp|Q7VDN6|MTAP_PROMA S-methyl-5'-thioadenosine phosphorylase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=mtnP PE=3 SV=1 64 288 4.0E-08
sp|A2BIU4|MTAP_HYPBU S-methyl-5'-thioadenosine phosphorylase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=mtnP PE=3 SV=1 69 347 4.0E-08
sp|A7SN31|MTAP_NEMVE S-methyl-5'-thioadenosine phosphorylase OS=Nematostella vectensis GN=v1g214799 PE=3 SV=1 151 288 7.0E-08
sp|Q9YAQ8|MTAP_AERPE S-methyl-5'-thioadenosine phosphorylase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=mtnP PE=1 SV=1 61 291 1.0E-07
sp|Q8DJE4|MTAP_THEEB S-methyl-5'-thioadenosine phosphorylase OS=Thermosynechococcus elongatus (strain BP-1) GN=mtnP PE=3 SV=1 68 303 2.0E-07
sp|Q1INC3|MTAP_KORVE S-methyl-5'-thioadenosine phosphorylase OS=Koribacter versatilis (strain Ellin345) GN=mtnP PE=3 SV=1 66 299 4.0E-07
sp|E3XFR6|MTAP_ANODA S-methyl-5'-thioadenosine phosphorylase OS=Anopheles darlingi GN=AND_22863 PE=3 SV=1 144 326 6.0E-07
sp|Q7NHW1|MTAP_GLOVI S-methyl-5'-thioadenosine phosphorylase OS=Gloeobacter violaceus (strain PCC 7421) GN=mtnP PE=3 SV=1 66 303 9.0E-07
sp|Q8PB40|MTIP_XANCP Probable S-methyl-5'-thioinosine phosphorylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC1285 PE=3 SV=1 210 288 1.0E-06
sp|Q4PH43|MTAP_USTMA S-methyl-5'-thioadenosine phosphorylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10466 PE=3 SV=3 69 314 5.0E-06
sp|A0QR54|MTAP_MYCS2 S-methyl-5'-thioadenosine phosphorylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtnP PE=1 SV=1 113 289 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0009116 nucleoside metabolic process Yes
GO:0006807 nitrogen compound metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901657 glycosyl compound metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|117280
MICMIRKFVWKLIFFSQSAVGLLPYTPEPPQSFKDKSTTDHQKGMKTNILSTVEYIRSQLPPELQQPRVGIVCGS
GLSGLAGIIQNIHTIPYANIPGFGTSTVPGHRSELAFGLLGKNGVPVVAMLGRFHFYEGHPLSTVVYPIRVMARL
GITEILITNAAGSLNPDIPTGTIVVVHDHIAFPGMTGTNPLMGPQTSPDHPRFLALSDAYSTSLRRLLFLAAHQL
SISKSALAEGTYAWVSGPNYETPAEGIFLRSIGVDVVGMSTVPEVLIAREEGLKVMVLSLVTNLVVIPPSYKSIR
EEVEAELAGQSFVTPEEQVVSHDEVLAVGKEKAEVIKSLVQRVVELLS*
Coding >AgabiH97|117280
ATGATATGTATGATCCGTAAGTTTGTTTGGAAATTGATCTTCTTCTCCCAATCGGCGGTTGGACTCCTACCATAT
ACCCCTGAACCTCCTCAATCGTTCAAAGATAAATCGACGACCGATCATCAAAAAGGGATGAAAACAAATATTCTT
TCTACAGTCGAGTATATCAGGTCTCAACTCCCTCCGGAGCTCCAGCAGCCCCGAGTTGGGATCGTGTGTGGATCC
GGTTTAAGTGGCCTCGCTGGGATTATCCAAAACATTCATACAATACCATATGCAAATATACCAGGTTTCGGGACT
AGCACAGTGCCAGGACATCGGAGCGAGCTCGCTTTTGGCTTGTTAGGCAAGAATGGTGTTCCAGTCGTCGCGATG
TTAGGAAGGTTTCACTTCTATGAAGGTCATCCCTTGTCAACTGTCGTTTATCCTATCCGAGTTATGGCGAGGCTG
GGCATCACGGAAATTTTGATCACCAACGCTGCCGGGTCTCTAAATCCAGATATCCCTACTGGAACCATTGTTGTT
GTTCATGATCACATTGCATTCCCTGGTATGACTGGGACGAACCCATTGATGGGGCCTCAAACTTCCCCGGACCAC
CCTCGTTTTCTTGCCCTTTCCGATGCATACTCCACTTCTCTCCGTCGCCTCCTTTTCCTGGCCGCCCATCAGCTG
TCTATCAGTAAATCTGCTTTGGCGGAAGGAACATACGCTTGGGTTTCTGGGCCAAATTACGAAACTCCGGCAGAA
GGTATATTCCTGAGGAGCATTGGTGTTGATGTTGTGGGTATGAGCACAGTTCCCGAAGTCCTTATAGCTAGGGAA
GAGGGCTTGAAAGTGATGGTGCTTAGCCTTGTTACCAACTTGGTCGTTATTCCTCCGTCGTATAAGAGTATCCGA
GAGGAGGTCGAAGCGGAGCTTGCAGGACAGTCTTTTGTTACGCCAGAGGAGCAAGTCGTATCGCATGACGAGGTA
CTTGCCGTGGGGAAGGAGAAAGCAGAAGTTATAAAAAGCCTTGTGCAGCGAGTGGTAGAACTCCTGTCCTAA
Transcript >AgabiH97|117280
ATGATATGTATGATCCGTAAGTTTGTTTGGAAATTGATCTTCTTCTCCCAATCGGCGGTTGGACTCCTACCATAT
ACCCCTGAACCTCCTCAATCGTTCAAAGATAAATCGACGACCGATCATCAAAAAGGGATGAAAACAAATATTCTT
TCTACAGTCGAGTATATCAGGTCTCAACTCCCTCCGGAGCTCCAGCAGCCCCGAGTTGGGATCGTGTGTGGATCC
GGTTTAAGTGGCCTCGCTGGGATTATCCAAAACATTCATACAATACCATATGCAAATATACCAGGTTTCGGGACT
AGCACAGTGCCAGGACATCGGAGCGAGCTCGCTTTTGGCTTGTTAGGCAAGAATGGTGTTCCAGTCGTCGCGATG
TTAGGAAGGTTTCACTTCTATGAAGGTCATCCCTTGTCAACTGTCGTTTATCCTATCCGAGTTATGGCGAGGCTG
GGCATCACGGAAATTTTGATCACCAACGCTGCCGGGTCTCTAAATCCAGATATCCCTACTGGAACCATTGTTGTT
GTTCATGATCACATTGCATTCCCTGGTATGACTGGGACGAACCCATTGATGGGGCCTCAAACTTCCCCGGACCAC
CCTCGTTTTCTTGCCCTTTCCGATGCATACTCCACTTCTCTCCGTCGCCTCCTTTTCCTGGCCGCCCATCAGCTG
TCTATCAGTAAATCTGCTTTGGCGGAAGGAACATACGCTTGGGTTTCTGGGCCAAATTACGAAACTCCGGCAGAA
GGTATATTCCTGAGGAGCATTGGTGTTGATGTTGTGGGTATGAGCACAGTTCCCGAAGTCCTTATAGCTAGGGAA
GAGGGCTTGAAAGTGATGGTGCTTAGCCTTGTTACCAACTTGGTCGTTATTCCTCCGTCGTATAAGAGTATCCGA
GAGGAGGTCGAAGCGGAGCTTGCAGGACAGTCTTTTGTTACGCCAGAGGAGCAAGTCGTATCGCATGACGAGGTA
CTTGCCGTGGGGAAGGAGAAAGCAGAAGTTATAAAAAGCCTTGTGCAGCGAGTGGTAGAACTCCTGTCCTAA
Gene >AgabiH97|117280
ATGATATGTATGATCCGTAAGTTTGTTTGGAAATTGATCTTCTTCTCCCAATCGGCGGTTGGACTCCTACCATAT
ACCCCTGAACCTCCTCAATCGTTCAAAGATAAATCGACGACCGATCATCAAAAAGGGATGAAAACAAATATTCTT
TCTACAGTCGAGTATATCAGGTCTCAACTCCCTCCGGAGCTCCAGCAGCCCCGAGTTGGGATCGTGTGTGGATCC
GGTTTAAGTGGCCTCGCTGGGATTATCCAAAACATTCATACAATACCATATGCAAATATACCAGGTTTCGGGACT
AGCACAGGTATTGTAATCTGTATATACATACATCATTCTCAATACTCAACTATACCCAAGTGCCAGGACATCGGA
GCGAGCTCGCTTTTGGCTTGTTAGGCAAGAATGGTGTTCCAGTCGTCGCGATGTTAGGAAGGGTAAGTACTTGGG
TTATGTGCTGCCATTCAAATCACTTTATTGACGTTCCGCAAGTTTCACTTCTATGAAGGTCATCCCTTGTCAACT
GTCGTTTATCCTATCCGAGTTATGGCGAGGCTGGGCATCACGGAAATTTTGAGTACGTTCAAGGGCTGTTAGAAT
TCTATTCTAATTGTTGAATGTGATGACATATCGTAGTCACCAACGCTGCCGGGTCTCTAAATCCAGATATCCCTA
CTGGAACCAGTACGTCTCATCGAATAAATTTCAGTGATAACTTCTCATAAAAATCTCACCAAGTTGTTGTTGTTC
ATGATCACATTGCATTCCCTGGTATGACTGGGACGAACCCATTGATGGGGCCTCAAACTTCCCCGGACCACCCTC
GTTTTCTTGCCCTTTCCGATGCATACTCCACTTCTCTCCGTCGCCTCCTTTTCCTGGCCGCCCATCAGCTGTCTA
TCAGTAAATCTGCTTTGGCGGAAGGAACATACGCTTGGGTTTCTGGGCCAAATTACGAAACTCCGGCAGAAGGTA
TATTCCTGAGGAGCATTGGTGTTGATGTTGTGGGTATGAGCACAGTTCCCGAAGTCCTTATAGCTAGGGAAGAGG
GCTTGAAAGTGATGGTGCTTAGCCTTGTTACCAACTTGGTCGTTATTCCTCCGTCGTATAAGAGTATCCGAGAGG
AGGTCGAAGCGGAGGTTCATATCTTTCAAATGACTATTCTTTCGAATTACGACTAACTCAGTGAATTTACAGCTT
GCAGGACAGTCTTTTGTTACGCCAGAGGAGCAAGTCGTATCGCATGACGAGGTACTTGCCGTGGGGAAGGAGAAA
GCAGAAGTTATAAAAAGCCTTGTGCAGCGAGTGGTAGAACTCCTGTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail