Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|117220
Gene name
Locationscaffold_9:945274..949511
Strand+
Gene length (bp)4237
Transcript length (bp)3372
Coding sequence length (bp)3372
Protein length (aa) 1124

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10366 Vps39_1 Vacuolar sorting protein 39 domain 1 4.1E-24 726 826
PF10367 Vps39_2 Vacuolar sorting protein 39 domain 2 1.7E-23 1008 1112
PF00780 CNH CNH domain 7.2E-12 25 331
PF00637 Clathrin Region in Clathrin and VPS 4.2E-12 845 976

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R5L3|VPS39_MOUSE Vam6/Vps39-like protein OS=Mus musculus GN=Vps39 PE=1 SV=1 721 1111 1.0E-46
sp|Q96JC1|VPS39_HUMAN Vam6/Vps39-like protein OS=Homo sapiens GN=VPS39 PE=1 SV=2 721 1111 5.0E-46
sp|O13955|VAM6_SCHPO Vacuolar morphogenesis protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vam6 PE=3 SV=1 658 1115 2.0E-42
sp|Q8WUH2|TGFA1_HUMAN Transforming growth factor-beta receptor-associated protein 1 OS=Homo sapiens GN=TGFBRAP1 PE=1 SV=1 722 1120 9.0E-29
sp|Q3UR70|TGFA1_MOUSE Transforming growth factor-beta receptor-associated protein 1 OS=Mus musculus GN=Tgfbrap1 PE=1 SV=1 722 1111 3.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8R5L3|VPS39_MOUSE Vam6/Vps39-like protein OS=Mus musculus GN=Vps39 PE=1 SV=1 721 1111 1.0E-46
sp|Q96JC1|VPS39_HUMAN Vam6/Vps39-like protein OS=Homo sapiens GN=VPS39 PE=1 SV=2 721 1111 5.0E-46
sp|O13955|VAM6_SCHPO Vacuolar morphogenesis protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vam6 PE=3 SV=1 658 1115 2.0E-42
sp|Q8WUH2|TGFA1_HUMAN Transforming growth factor-beta receptor-associated protein 1 OS=Homo sapiens GN=TGFBRAP1 PE=1 SV=1 722 1120 9.0E-29
sp|Q3UR70|TGFA1_MOUSE Transforming growth factor-beta receptor-associated protein 1 OS=Mus musculus GN=Tgfbrap1 PE=1 SV=1 722 1111 3.0E-28
sp|A7MB11|TGFA1_BOVIN Transforming growth factor-beta receptor-associated protein 1 OS=Bos taurus GN=TGFBRAP1 PE=2 SV=1 722 1111 1.0E-24
sp|Q07468|VAM6_YEAST Vacuolar morphogenesis protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAM6 PE=1 SV=1 725 1120 4.0E-21
sp|A4IG72|TGFA1_DANRE Transforming growth factor-beta receptor-associated protein 1 homolog OS=Danio rerio GN=tgfbrap1 PE=2 SV=1 722 1111 2.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0016192 vesicle-mediated transport Yes
GO:0045184 establishment of protein localization No
GO:0015031 protein transport No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0008150 biological_process No
GO:0046907 intracellular transport No
GO:0070727 cellular macromolecule localization No
GO:0071702 organic substance transport No
GO:0051649 establishment of localization in cell No
GO:0051234 establishment of localization No
GO:0051641 cellular localization No
GO:0033036 macromolecule localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|117220
MAPFFAPKRLVSSLGEKAESLCQHGDRLYVGTSNGNLLIYEVTNAPDGGTSIKLMDTKKGLVRRAIDQLGFVREI
NSLIVLSEMTVTLFPVPGFTPSTVLVKAKAAFSFGLHTTIQHSPASTSVGTGKDASNIATPPSATIGLPGSMADS
FSHPNAGATTMSIPSVVTQLLVGCRRKVVVYTWKDGEAQEIKEALIPHSPRAIAFLDADTAGFAYAPDYAIFSIP
TMSIVDVTLPLPTAISATMGMGAFSGLTGYMSLGLGAKAKPTIAPVGNGEVLIGKDSEGIFVGKDGRPSGEKNIA
WVASPDEIAYIRPYVFSVFPAGTIPSEILDASTTSESASIVPSSSGNGVQQPPSMIRTSVVQIRSSISAHVLQNF
TIPFPVPSSPSPAGSVTADNKSSTDTVATTSTSTSLPSTAVQNASIHIPLFSSSTKSPLYMITTPVDRTVAAAEG
SSIWQFGMRPWAEQIDELVENGYYADALSLLDVIDESALLDKVQRHTRIRALNAVSQFRASKFKEALDTFLELDI
NPAKVIALYPEAVSRRLSVPQKEWVSLYGGPAPSPDSASTSPLPGSGSGEPPGEDGAGGETVGGKHEKSSSEPAG
TTITNSLGGSGVGTGAIRRLKGAGLGFLGAHGYKEKGDSDTASIHSVRRGVVKDDFRRSIEALTGYLVDRRTKLD
PVLTSVNITFQNQHDDHKPLSEVPIDELFALPDAPLSVLTPEELLRFAQVVDTALYKSYIIIRPGLLKSFCSLPN
WCEVSEVEEDLRGIQRFAELKDLYYGKKMHAKALQLLKDLSEEVSDIEDKLRPSITYLQKLGPEYLDHIFQFSRW
IFDQNVDMGFEIFLSEDVELPHQAVANYLESINSKICAKYLEYIIEERHEETPAYHDRLAELYISMTLNAKRRNE
DTTRKEVYAKLLQFLNTNDKIGADRLYGILSPTDLYEARAILLGRLGRHDQALELYVYHLHDYYKAEEYCKQIYQ
PKSPTSNVFLTLLRIYLRPTIKPTPTDLLAPALELISRHNPRLDPVETLNLLPPLVTAEDVRAFLIEALRAPIFD
TRVVKHLSKARSDQVARRLMALQTRRVRVTDSRICPQCHKRIGNSVIAVHAPRGEVTHYQCREAFSRKLNVVT*
Coding >AgabiH97|117220
ATGGCACCATTCTTTGCACCCAAACGACTCGTGTCTTCCCTTGGAGAGAAAGCCGAGTCACTGTGCCAGCATGGC
GACAGGCTATATGTCGGAACGAGTAATGGGAATCTACTAATATATGAAGTAACAAATGCCCCTGATGGGGGAACT
AGCATCAAGTTAATGGACACAAAGAAGGGTCTCGTCAGAAGGGCAATTGACCAGCTGGGGTTCGTAAGAGAGATA
AACTCGTTGATTGTCCTCTCCGAAATGACAGTGACCCTCTTTCCTGTTCCGGGATTCACACCATCCACAGTGCTT
GTTAAGGCAAAGGCAGCATTCTCATTTGGTTTGCACACAACCATACAACATTCACCTGCCTCAACTTCGGTTGGT
ACAGGAAAGGATGCGTCAAATATTGCCACTCCTCCATCAGCTACGATTGGGCTGCCCGGAAGCATGGCAGATAGC
TTTTCCCATCCCAACGCTGGGGCAACAACTATGTCGATACCGAGCGTGGTCACGCAGCTTTTGGTTGGATGTAGA
CGAAAAGTGGTAGTATATACGTGGAAAGATGGAGAAGCTCAAGAAATCAAAGAAGCTCTTATACCTCATTCGCCT
CGCGCGATTGCGTTTCTTGATGCTGACACCGCTGGATTTGCCTATGCTCCTGATTATGCCATATTCTCCATCCCT
ACAATGAGTATCGTAGACGTGACTTTGCCGCTTCCTACGGCAATATCCGCGACTATGGGTATGGGTGCATTCAGC
GGTTTGACTGGATACATGTCACTTGGACTTGGCGCTAAAGCGAAACCTACTATTGCGCCTGTTGGTAACGGAGAG
GTGTTGATCGGGAAAGACAGCGAAGGAATCTTTGTCGGGAAAGACGGAAGACCTTCGGGGGAGAAGAATATTGCA
TGGGTAGCCTCACCCGACGAGATAGCTTATATCCGACCCTATGTTTTTTCCGTGTTTCCTGCCGGTACAATACCA
TCCGAAATACTCGACGCATCAACAACATCTGAATCCGCTTCTATTGTTCCAAGCTCGTCTGGTAATGGTGTACAG
CAACCGCCGAGCATGATACGTACGAGTGTCGTCCAGATACGCTCATCTATCTCCGCTCACGTGTTACAAAATTTC
ACGATACCATTTCCTGTCCCCTCATCCCCTTCTCCTGCGGGGTCGGTTACGGCCGATAACAAGTCTTCGACAGAT
ACTGTGGCGACGACTTCCACCTCTACCTCTCTTCCGTCAACTGCGGTCCAGAATGCTTCAATTCACATACCCCTT
TTCTCCTCCTCAACTAAGTCTCCATTGTACATGATCACTACCCCAGTCGACAGGACAGTAGCGGCAGCAGAAGGC
AGTTCGATATGGCAATTTGGTATGCGTCCTTGGGCAGAACAAATCGACGAGCTCGTTGAGAATGGATATTATGCG
GATGCATTGAGCCTGCTTGATGTCATAGACGAAAGTGCTCTTCTTGACAAAGTACAAAGACACACGCGCATTCGC
GCTCTCAATGCTGTATCCCAATTTCGTGCATCAAAATTCAAAGAAGCTCTTGATACTTTTCTTGAATTGGACATT
AACCCTGCAAAAGTCATCGCTTTGTATCCTGAAGCTGTTTCGCGGAGATTATCTGTTCCTCAGAAAGAGTGGGTA
TCATTGTACGGAGGACCTGCACCTTCTCCCGACAGCGCCTCCACATCTCCGCTCCCTGGCAGCGGAAGCGGTGAA
CCGCCCGGGGAAGATGGTGCTGGAGGAGAGACGGTCGGGGGCAAACACGAGAAGAGTTCGTCGGAGCCCGCAGGC
ACAACCATTACGAATTCACTCGGTGGTAGCGGTGTAGGAACTGGTGCTATCAGACGTCTAAAAGGTGCTGGTTTA
GGGTTCTTGGGTGCTCATGGATATAAGGAGAAGGGTGATTCTGACACTGCGTCAATTCACAGTGTTCGCCGGGGT
GTTGTCAAAGACGATTTCCGCCGCTCCATAGAAGCACTCACTGGTTACCTTGTCGACAGACGTACCAAATTGGAC
CCAGTCCTCACCTCAGTCAATATAACATTCCAGAACCAACACGATGATCACAAACCATTATCTGAAGTACCCATC
GACGAACTCTTTGCTCTACCCGATGCCCCGTTGAGCGTATTAACACCAGAAGAGCTGTTGAGATTTGCTCAGGTG
GTGGATACGGCATTGTATAAATCATACATTATTATCCGACCTGGCTTGTTGAAGTCATTTTGTTCGTTGCCGAAT
TGGTGTGAGGTAAGTGAGGTTGAGGAAGATTTGAGAGGTATCCAGAGGTTTGCGGAGTTGAAGGATTTGTATTAC
GGGAAGAAGATGCATGCGAAGGCATTACAACTGCTCAAAGACCTTAGTGAAGAGGTATCCGACATAGAAGACAAG
CTTCGTCCTTCAATAACCTACCTCCAAAAACTAGGCCCGGAGTACCTAGATCATATATTCCAATTCTCCAGATGG
ATTTTTGATCAGAATGTGGACATGGGCTTTGAGATCTTTCTCTCGGAAGACGTCGAATTACCTCACCAAGCCGTT
GCGAATTACCTCGAAAGTATTAACTCAAAGATTTGCGCCAAGTATCTCGAGTACATCATAGAGGAACGTCATGAA
GAGACACCGGCGTATCACGATAGATTGGCGGAATTGTATATCAGCATGACGCTCAATGCGAAGAGAAGGAACGAG
GATACGACGAGGAAGGAGGTTTATGCAAAATTGCTCCAGTTCCTGAATACGAATGATAAAATTGGAGCTGATAGG
TTGTATGGTATCTTATCACCGACTGATCTGTACGAAGCTCGCGCAATATTGCTAGGAAGATTGGGCCGACATGAT
CAGGCACTCGAACTCTATGTCTACCATCTCCATGATTACTACAAAGCTGAAGAATACTGCAAACAGATCTATCAA
CCTAAATCACCAACATCGAACGTCTTTCTTACCCTTCTGCGGATATATCTCAGGCCTACAATTAAACCAACTCCG
ACCGACCTTCTCGCACCGGCATTAGAACTCATCTCGCGACATAATCCACGCTTAGATCCGGTAGAAACTCTGAAT
TTGTTACCGCCCTTGGTCACAGCGGAAGATGTACGAGCGTTCCTGATAGAGGCACTACGTGCACCGATCTTTGAT
ACAAGGGTCGTTAAACATTTGAGTAAGGCGAGGAGTGATCAAGTTGCGAGACGACTGATGGCGCTACAAACGAGG
AGAGTGAGAGTGACTGACAGTCGGATATGCCCACAGTGTCATAAGAGGATTGGGAACAGCGTTATCGCCGTTCAT
GCACCTCGGGGTGAGGTCACTCATTATCAATGTCGGGAGGCGTTCTCTCGCAAGTTGAATGTGGTTACATAG
Transcript >AgabiH97|117220
ATGGCACCATTCTTTGCACCCAAACGACTCGTGTCTTCCCTTGGAGAGAAAGCCGAGTCACTGTGCCAGCATGGC
GACAGGCTATATGTCGGAACGAGTAATGGGAATCTACTAATATATGAAGTAACAAATGCCCCTGATGGGGGAACT
AGCATCAAGTTAATGGACACAAAGAAGGGTCTCGTCAGAAGGGCAATTGACCAGCTGGGGTTCGTAAGAGAGATA
AACTCGTTGATTGTCCTCTCCGAAATGACAGTGACCCTCTTTCCTGTTCCGGGATTCACACCATCCACAGTGCTT
GTTAAGGCAAAGGCAGCATTCTCATTTGGTTTGCACACAACCATACAACATTCACCTGCCTCAACTTCGGTTGGT
ACAGGAAAGGATGCGTCAAATATTGCCACTCCTCCATCAGCTACGATTGGGCTGCCCGGAAGCATGGCAGATAGC
TTTTCCCATCCCAACGCTGGGGCAACAACTATGTCGATACCGAGCGTGGTCACGCAGCTTTTGGTTGGATGTAGA
CGAAAAGTGGTAGTATATACGTGGAAAGATGGAGAAGCTCAAGAAATCAAAGAAGCTCTTATACCTCATTCGCCT
CGCGCGATTGCGTTTCTTGATGCTGACACCGCTGGATTTGCCTATGCTCCTGATTATGCCATATTCTCCATCCCT
ACAATGAGTATCGTAGACGTGACTTTGCCGCTTCCTACGGCAATATCCGCGACTATGGGTATGGGTGCATTCAGC
GGTTTGACTGGATACATGTCACTTGGACTTGGCGCTAAAGCGAAACCTACTATTGCGCCTGTTGGTAACGGAGAG
GTGTTGATCGGGAAAGACAGCGAAGGAATCTTTGTCGGGAAAGACGGAAGACCTTCGGGGGAGAAGAATATTGCA
TGGGTAGCCTCACCCGACGAGATAGCTTATATCCGACCCTATGTTTTTTCCGTGTTTCCTGCCGGTACAATACCA
TCCGAAATACTCGACGCATCAACAACATCTGAATCCGCTTCTATTGTTCCAAGCTCGTCTGGTAATGGTGTACAG
CAACCGCCGAGCATGATACGTACGAGTGTCGTCCAGATACGCTCATCTATCTCCGCTCACGTGTTACAAAATTTC
ACGATACCATTTCCTGTCCCCTCATCCCCTTCTCCTGCGGGGTCGGTTACGGCCGATAACAAGTCTTCGACAGAT
ACTGTGGCGACGACTTCCACCTCTACCTCTCTTCCGTCAACTGCGGTCCAGAATGCTTCAATTCACATACCCCTT
TTCTCCTCCTCAACTAAGTCTCCATTGTACATGATCACTACCCCAGTCGACAGGACAGTAGCGGCAGCAGAAGGC
AGTTCGATATGGCAATTTGGTATGCGTCCTTGGGCAGAACAAATCGACGAGCTCGTTGAGAATGGATATTATGCG
GATGCATTGAGCCTGCTTGATGTCATAGACGAAAGTGCTCTTCTTGACAAAGTACAAAGACACACGCGCATTCGC
GCTCTCAATGCTGTATCCCAATTTCGTGCATCAAAATTCAAAGAAGCTCTTGATACTTTTCTTGAATTGGACATT
AACCCTGCAAAAGTCATCGCTTTGTATCCTGAAGCTGTTTCGCGGAGATTATCTGTTCCTCAGAAAGAGTGGGTA
TCATTGTACGGAGGACCTGCACCTTCTCCCGACAGCGCCTCCACATCTCCGCTCCCTGGCAGCGGAAGCGGTGAA
CCGCCCGGGGAAGATGGTGCTGGAGGAGAGACGGTCGGGGGCAAACACGAGAAGAGTTCGTCGGAGCCCGCAGGC
ACAACCATTACGAATTCACTCGGTGGTAGCGGTGTAGGAACTGGTGCTATCAGACGTCTAAAAGGTGCTGGTTTA
GGGTTCTTGGGTGCTCATGGATATAAGGAGAAGGGTGATTCTGACACTGCGTCAATTCACAGTGTTCGCCGGGGT
GTTGTCAAAGACGATTTCCGCCGCTCCATAGAAGCACTCACTGGTTACCTTGTCGACAGACGTACCAAATTGGAC
CCAGTCCTCACCTCAGTCAATATAACATTCCAGAACCAACACGATGATCACAAACCATTATCTGAAGTACCCATC
GACGAACTCTTTGCTCTACCCGATGCCCCGTTGAGCGTATTAACACCAGAAGAGCTGTTGAGATTTGCTCAGGTG
GTGGATACGGCATTGTATAAATCATACATTATTATCCGACCTGGCTTGTTGAAGTCATTTTGTTCGTTGCCGAAT
TGGTGTGAGGTAAGTGAGGTTGAGGAAGATTTGAGAGGTATCCAGAGGTTTGCGGAGTTGAAGGATTTGTATTAC
GGGAAGAAGATGCATGCGAAGGCATTACAACTGCTCAAAGACCTTAGTGAAGAGGTATCCGACATAGAAGACAAG
CTTCGTCCTTCAATAACCTACCTCCAAAAACTAGGCCCGGAGTACCTAGATCATATATTCCAATTCTCCAGATGG
ATTTTTGATCAGAATGTGGACATGGGCTTTGAGATCTTTCTCTCGGAAGACGTCGAATTACCTCACCAAGCCGTT
GCGAATTACCTCGAAAGTATTAACTCAAAGATTTGCGCCAAGTATCTCGAGTACATCATAGAGGAACGTCATGAA
GAGACACCGGCGTATCACGATAGATTGGCGGAATTGTATATCAGCATGACGCTCAATGCGAAGAGAAGGAACGAG
GATACGACGAGGAAGGAGGTTTATGCAAAATTGCTCCAGTTCCTGAATACGAATGATAAAATTGGAGCTGATAGG
TTGTATGGTATCTTATCACCGACTGATCTGTACGAAGCTCGCGCAATATTGCTAGGAAGATTGGGCCGACATGAT
CAGGCACTCGAACTCTATGTCTACCATCTCCATGATTACTACAAAGCTGAAGAATACTGCAAACAGATCTATCAA
CCTAAATCACCAACATCGAACGTCTTTCTTACCCTTCTGCGGATATATCTCAGGCCTACAATTAAACCAACTCCG
ACCGACCTTCTCGCACCGGCATTAGAACTCATCTCGCGACATAATCCACGCTTAGATCCGGTAGAAACTCTGAAT
TTGTTACCGCCCTTGGTCACAGCGGAAGATGTACGAGCGTTCCTGATAGAGGCACTACGTGCACCGATCTTTGAT
ACAAGGGTCGTTAAACATTTGAGTAAGGCGAGGAGTGATCAAGTTGCGAGACGACTGATGGCGCTACAAACGAGG
AGAGTGAGAGTGACTGACAGTCGGATATGCCCACAGTGTCATAAGAGGATTGGGAACAGCGTTATCGCCGTTCAT
GCACCTCGGGGTGAGGTCACTCATTATCAATGTCGGGAGGCGTTCTCTCGCAAGTTGAATGTGGTTACATAG
Gene >AgabiH97|117220
ATGGCACCATTCTTTGCACCCAAACGACTCGTGTCTTCCCTTGGAGAGAAAGCCGAGTCACTGTGCCAGCATGGT
CTGTCCATTCGGTCATTGTTCCTTGGACGCACTCAAGTTAACCGTGATGCAAAGGCGACAGGCTATATGTCGGAA
CGAGTAATGGGAATCTACTAATATATGAAGTAACAAATGCCCCTGGTATGTCTGTCTCTAAACTTGTTACGCCTC
AGCTGTAGATGTGTAGGTGAAGATGGGGGAACTAGCATCAAGTTAATGGACACAAAGAAGGGTCTCGTCAGAAGG
GCAATTGACCAGCTGGGGTTCGTAAGAGAGATAAACTCGTTGATTGTCCTCTCCGGTACGTTACTGATACTGCAT
TGTGGATTTCGTCGCGATTCTCATCGGTGGTGTGTGTCTGTAGAAATGACAGTGACCCTCTTTCCTGTTCCGGGA
TTCACACCATCCACAGTGCTTGTTAAGGCAAAGGCAGCATTCTCATTTGGTTTGCACACAACCATACAACATTCA
CCTGCCTCAACTTCGGTTGGTACAGGAAAGGATGCGTCAAATATTGCCACTCCTCCATCAGCTACGATTGGGCTG
CCCGGAAGCATGGCAGATAGCTTTTCCCATCCCAACGCTGGGGCAACAACTATGTCGATACCGAGCGTGGTCACG
CAGCTTTTGGTTGGATGTAGACGAAAAGTGGTAGTATATACGTGGAAAGATGGAGAAGCTCAAGAAATCAAAGTA
TGTTTCATTTATTCATCTGTGCCACCCATAACTTACTACCAATCATTTCGTAGGAAGCTCTTATACCTCATTCGC
CTCGCGCGATTGCGTTTCTTGATGCTGACACCGCTGGATTTGCCTATGCTCCTGATTATGCCATATTCTCCATCC
CTACAATGAGTATCGTAGACGTGACTTTGCCGCTTCCTACGGCAATATCCGCGACTATGGGTATGGGTGCATTCA
GCGGTTTGACTGGATACATGTCACTTGGACTTGGCGCTAAAGCGAAACCTACTATTGCGCCTGTTGGTAACGGAG
AGGTGTTGATCGGGAAAGACAGTATGTGGTACCTGTTTTGTTTGTCGAGAGTATTCTGATCAGTATTTCTGGTTA
TAGGCGAAGGAATCTTTGTCGGGAAAGACGGAAGACCTTCGGGGGAGAAGAATATTGCATGGGTAGCCTCACCCG
ACGAGATAGCTTATATCCGACCCTATGTTTTTTCCGTGTTTCCTGCCGGTACAATACCATCCGAAATACTCGACG
CATCAACAACATCTGAATCCGCTTCTATTGTTCCAAGCTCGTCTGGTAATGGTGTACAGCAACCGCCGAGCATGA
TACGTACGAGTGTCGTCCAGATACGCTCATCTATCTCCGCTCACGTGTTACAAAATTTCACGATACCATTTCCTG
TCCCCTCATCCCCTTCTCCTGCGGGGTCGGTTACGGCCGATAACAAGTCTTCGACAGATACTGTGGCGACGACTT
CCACCTCTACCTCTCTTCCGTCAACTGCGGTCCAGAATGCTTCAATTCACATACCCCTTTTCTCCTCCTCAACTA
AGTCTCCATTGTACATGATCACTACCCCAGTCGACAGGACAGTAGCGGCAGCAGAAGGCAGTTCGATATGGCAAT
TTGGTATGCGTCCTTGGGCAGAACAAATCGACGAGCTCGTTGAGAATGGATATTATGCGGATGCATTGAGCCTGC
TTGATGTCATAGACGAAAGTGCTCTTCTTGACAAAGTACGCATTTAGTCCCTCCTATGCTCATTCTGACTAAGAT
TCGACCGATTATCATGTTATGAAGGTACAAAGACACACGCGCATTCGCGCTCTCAATGCTGTATCCCAATTTCGT
GCATCAAAATTCAAAGAAGCTCTTGATACTTTTCTTGAATTGGACATTAACCCTGCAAAAGTCATCGCTTTGTAT
CCTGAAGCTGTTTCGCGGAGATTATCTGTTCCTCAGAAAGAGTGGGTATCATTGTACGGAGGACCTGCACCTTCT
CCCGACAGCGCCTCCACATCTCCGCTCCCTGGCAGCGGAAGCGGTGAACCGCCCGGGGAAGATGGTGCTGGAGGA
GAGACGGTCGGGGGCAAACACGAGAAGAGTTCGTCGGAGCCCGCAGGCACAACCATTACGAATTCACTCGGTGGT
AGCGGTGTAGGAACTGGTGCTATCAGACGTCTAAAAGGTGCTGGTTTAGGGTTCTTGGGTGCTCATGGATATAAG
GAGAAGGGTGATTCTGACACTGCGTCAATTCACAGTGTTCGCCGGGGTGTTGTCAAAGGTGAGTGACTCGCTATA
CAGATCACGTCGATGAATAAATTTCCATTCCCGCAGACGATTTCCGCCGCTCCATAGAAGCACTCACTGGTTACC
TTGTCGACAGACGTACCAAATTGGACCCAGTCCTCACCTCAGTCAATATAACATTCCAGAACCAACACGATGATC
ACAAACCATTATCTGAAGTACCCATCGACGAACTCTTTGCTCTACCCGATGCCCCGTTGAGCGTATTAACACCAG
AAGAGCTGTTGAGATTTGCTCAGGTGGTGGATACGGCATTGTATAAATCATACATTATTATCCGACCTGGCTTGT
TGAAGTCATTTTGTTCGTTGCCGAATTGGTGTGAGGTAAGTGAGGTTGAGGAAGATTTGAGAGGTATCCAGGTGG
GCATCCTTGTATCATCTTGTTGATAATACGGTGATGAGATGGTTTGGACCCTACAGAGGTTTGCGGAGTTGAAGG
ATTTGTATTACGGGAAGAAGATGCATGCGAAGGCATTACAACTGCTCAAAGAGTGCGTGTTTGTGTTTATATATA
TAATATTCTTTCATTGTTGATATCTAGCGGTTTGCAGCCTTAGTGAAGAGGTATCCGACATAGAAGACAAGCTTC
GTCCTTCAATAACCTACCTCCAAAAACTAGGCCCGGAGTACCTAGATCATATATTCCAATTCTCCAGATGGATTT
TTGATCAGAATGTGGACATGGGCTTTGAGGTACGAGATCTATCGTTGAATTTTATTCAAACCTGTATTGAGAACT
GTCTTGTACCGTAGATCTTTCTCTCGGAAGACGTCGAATTACCTCACCAAGCCGTTGCGAATTACCTCGAAAGTA
TTAACTCAAAGATTTGCGCCAAGTATCTCGAGTACATCATAGAGGAACGTCATGAAGAGACACCGGCGTATCACG
ATAGATTGGCGGAATTGTATATCAGCATGACGCTCAATGCGAAGAGAAGGAACGAGGATAGTAAGTGTATTCTCC
TTGAATTAATGAAAACAATACGCTGATGGCAATACTTTCACAGCGACGAGGAAGGAGGTTTATGCAAAATTGCTC
CAGTTCCTGAATACGAATGATAAAATTGGAGCTGATAGGTTGTATGGTATCTTATCACCGACTGGTAAGCTACCT
TTCCATGCTCAGCCTCTAATCCTAATTGTATTACCATGGAAGATCTGTACGAAGCTCGCGCAATATTGCTAGGAA
GATTGGGCCGACATGATCAGGCACTCGAACTCTATGTCTACCATCTCCATGATTACTACAAAGCTGAAGAGTGGG
TTATTTTCTTTTGCACCTCGTGTCTTTCATGTACCGATTTGAAATGCTCTCGCTTGACATAGATACTGCAAACAG
ATCTATCAACCTAAATCACCAACATCGAACGTCTTTCTTACCCTTCTGCGGATATATCTCAGGCCTACAATTAAA
CCAACTCCGACCGACCTTCTCGCACCGGCATTAGAACTCATCTCGCGACATAATCCACGCTTAGATCCGGTAGAA
ACTCTGAATTTGTTACCGCCCTTGGTCACAGCGGAAGATGTACGAGCGTTCCTGATAGAGGCACTACGTGCACCG
ATCTTTGATACAAGGGTCGTTAAACATTTGAGTAAGGCGAGGAGTGATCAAGTTGCGAGACGACTGATGGCGCTA
CAAACGAGGAGAGTGAGAGTGACTGACAGTCGGATGTGAGTTGATTTTTTCTTTTTGTCTTTGCGGCTGTGATGT
TAATTTCCGTTGCCAGATGCCCACAGTGTCATAAGAGGATTGGGAACAGCGTTATCGCCGTTCATGCACCTCGGT
GAGTGTTTGATACTATAGTTTTTCACTCTTAGCCTTACCTTTTGACAGGGGTGAGGTCACTCATTATCAATGTCG
GGAGGCGTTCTCTCGCAAGTTGAATGTGGTTACATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail