Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|117170
Gene name
Locationscaffold_9:929026..931097
Strand-
Gene length (bp)2071
Transcript length (bp)1263
Coding sequence length (bp)1263
Protein length (aa) 421

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28 1.4E-43 80 410

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2EQQ2|RGXA_ASPNG Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger GN=rgxA PE=2 SV=1 9 416 2.0E-66
sp|A2QBB4|RGXA_ASPNC Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxA PE=2 SV=2 9 410 6.0E-66
sp|Q00293|PGLRX_ASPTU Exopolygalacturonase X OS=Aspergillus tubingensis GN=pgaX PE=1 SV=1 16 409 5.0E-61
sp|Q27UB3|PGLRX_ASPNG Exopolygalacturonase X OS=Aspergillus niger GN=pgaX PE=3 SV=1 16 408 1.0E-60
sp|A2R060|PGLRX_ASPNC Probable exopolygalacturonase X OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaX PE=3 SV=1 16 408 1.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2EQQ2|RGXA_ASPNG Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger GN=rgxA PE=2 SV=1 9 416 2.0E-66
sp|A2QBB4|RGXA_ASPNC Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxA PE=2 SV=2 9 410 6.0E-66
sp|Q00293|PGLRX_ASPTU Exopolygalacturonase X OS=Aspergillus tubingensis GN=pgaX PE=1 SV=1 16 409 5.0E-61
sp|Q27UB3|PGLRX_ASPNG Exopolygalacturonase X OS=Aspergillus niger GN=pgaX PE=3 SV=1 16 408 1.0E-60
sp|A2R060|PGLRX_ASPNC Probable exopolygalacturonase X OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaX PE=3 SV=1 16 408 1.0E-60
sp|Q2UP32|RGXA_ASPOR Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rgxA PE=3 SV=1 21 409 4.0E-60
sp|B8NJB0|RGXA_ASPFN Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rgxA PE=3 SV=2 21 409 4.0E-60
sp|Q00359|PGLRX_COCCA Exopolygalacturonase OS=Cochliobolus carbonum GN=PGX1 PE=3 SV=1 17 412 4.0E-58
sp|A1DLC1|PGLRX_NEOFI Probable exopolygalacturonase X OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaX PE=3 SV=2 24 409 1.0E-57
sp|Q4WCZ8|PGLRX_ASPFU Probable exopolygalacturonase X OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaX PE=3 SV=2 24 409 2.0E-57
sp|B0YDE8|PGLRX_ASPFC Probable exopolygalacturonase X OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaX PE=3 SV=2 24 409 2.0E-57
sp|A2RAY7|RGXC_ASPNC Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxC PE=2 SV=1 26 392 5.0E-56
sp|Q5ASG9|PGLX1_EMENI Exopolygalacturonase X-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaX-1 PE=1 SV=1 16 419 4.0E-54
sp|B8NG16|PGLRX_ASPFN Probable exopolygalacturonase X OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaX PE=3 SV=1 16 409 4.0E-54
sp|Q0CGP0|PGLRX_ASPTN Probable exopolygalacturonase X OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgaX PE=3 SV=1 16 408 5.0E-54
sp|A2QG68|RGXB_ASPNC Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxB PE=2 SV=2 26 408 5.0E-50
sp|Q5ARN5|PGLX2_EMENI Exopolygalacturonase X-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaX-2 PE=2 SV=1 24 407 4.0E-47
sp|A1D415|RGXC_NEOFI Putative galacturan 1,4-alpha-galacturonidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rgxC PE=3 SV=1 7 390 7.0E-45
sp|Q2TW03|PGXB_ASPOR Probable exopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgxB PE=3 SV=2 36 418 5.0E-41
sp|B8NX60|PGXB_ASPFN Probable exopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgxB PE=3 SV=1 36 418 7.0E-41
sp|Q0C7H7|PGXB_ASPTN Probable exopolygalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgxB PE=3 SV=1 10 418 1.0E-39
sp|Q873X6|PGXB_EMENI Probable exopolygalacturonase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgxB PE=2 SV=1 12 400 2.0E-39
sp|Q27UB2|PGXA_ASPNG Exopolygalacturonase A OS=Aspergillus niger GN=pgxA PE=3 SV=1 26 408 7.0E-36
sp|A2QW66|PGXA_ASPNC Probable exopolygalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgxA PE=3 SV=1 26 408 7.0E-36
sp|A1DAX2|PGXB_NEOFI Probable exopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgxB PE=3 SV=1 16 418 1.0E-35
sp|Q4WBK6|PGXB_ASPFU Probable exopolygalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgxB PE=3 SV=2 45 418 4.0E-35
sp|B0YAA4|PGXB_ASPFC Probable exopolygalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgxB PE=3 SV=2 45 418 5.0E-35
sp|Q27UB1|PGXB_ASPNG Exopolygalacturonase B OS=Aspergillus niger GN=pgxB PE=3 SV=1 45 419 1.0E-34
sp|A2QHG0|PGXB_ASPNC Probable exopolygalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgxB PE=3 SV=1 45 419 1.0E-34
sp|A2QK83|XGHA_ASPNC Probable endo-xylogalacturonan hydrolase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xghA PE=3 SV=1 33 408 2.0E-32
sp|I1BYN6|RPG16_RHIO9 Exopolygalacturonase rpg16 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg16 PE=1 SV=1 33 408 3.0E-32
sp|Q9UUZ2|XGHA_ASPTU Endo-xylogalacturonan hydrolase A OS=Aspergillus tubingensis GN=xghA PE=1 SV=1 33 408 4.0E-32
sp|B0Y9F8|XGHA_ASPFC Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xghA PE=3 SV=2 35 408 4.0E-31
sp|Q4WBT4|XGHA_ASPFU Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xghA PE=3 SV=2 35 408 2.0E-30
sp|A1DBT5|XGHA_NEOFI Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xghA PE=3 SV=1 33 408 2.0E-30
sp|B8NPS8|XGHA_ASPFN Probable endo-xylogalacturonan hydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xghA PE=3 SV=1 33 408 1.0E-28
sp|Q2UBD8|XGHA_ASPOR Probable endo-xylogalacturonan hydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xghA PE=3 SV=1 33 408 1.0E-27
sp|P48978|PGLR_MALDO Polygalacturonase OS=Malus domestica PE=2 SV=1 32 397 2.0E-27
sp|Q94AJ5|PGLR5_ARATH Probable polygalacturonase At1g80170 OS=Arabidopsis thaliana GN=At1g80170 PE=1 SV=1 122 410 6.0E-26
sp|I1BYM7|RPG15_RHIO9 Exopolygalacturonase rpg15 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg15 PE=1 SV=1 33 406 1.0E-25
sp|Q02096|PGLR_PERAE Polygalacturonase OS=Persea americana PE=2 SV=1 32 395 2.0E-25
sp|O23147|ADPG1_ARATH Polygalacturonase ADPG1 OS=Arabidopsis thaliana GN=ADPG1 PE=2 SV=1 104 410 3.0E-24
sp|Q9FY19|PGLR2_JUNAS Polygalacturonase OS=Juniperus ashei GN=JNA2 PE=1 SV=1 36 392 1.0E-23
sp|P35336|PGLR_ACTDE Polygalacturonase OS=Actinidia deliciosa PE=2 SV=1 122 408 1.0E-23
sp|Q949Z1|PGLR4_ARATH Polygalacturonase At1g48100 OS=Arabidopsis thaliana GN=At1g48100 PE=2 SV=1 57 410 1.0E-21
sp|Q7M1E7|PGLR2_CHAOB Polygalacturonase OS=Chamaecyparis obtusa PE=1 SV=1 75 396 1.0E-21
sp|Q5B7U1|XGHA_EMENI Probable endo-xylogalacturonan hydrolase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xghA PE=3 SV=1 33 400 2.0E-21
sp|Q9SFB7|QRT2_ARATH Polygalacturonase QRT2 OS=Arabidopsis thaliana GN=QRT2 PE=1 SV=2 122 395 4.0E-21
sp|Q6H9K0|PGLR2_PLAAC Exopolygalacturonase (Fragment) OS=Platanus acerifolia GN=plaa2 PE=1 SV=1 117 408 6.0E-20
sp|P05117|PGLR_SOLLC Polygalacturonase-2 OS=Solanum lycopersicum GN=PG2 PE=1 SV=1 132 410 9.0E-20
sp|P35339|PGLR3_MAIZE Exopolygalacturonase OS=Zea mays GN=PG2C PE=2 SV=1 27 410 1.0E-19
sp|P49062|PGLR1_ARATH Exopolygalacturonase clone GBGE184 OS=Arabidopsis thaliana GN=PGA3 PE=2 SV=1 123 416 1.0E-19
sp|P26216|PGLR1_MAIZE Exopolygalacturonase OS=Zea mays GN=PG1 PE=1 SV=1 27 396 2.0E-19
sp|P43212|PGLR2_CRYJA Polygalacturonase OS=Cryptomeria japonica PE=1 SV=1 123 396 2.0E-19
sp|P35338|PGLR2_MAIZE Exopolygalacturonase OS=Zea mays GN=PG9 PE=2 SV=1 27 396 7.0E-19
sp|Q9LW07|PGLR3_ARATH Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana GN=At3g15720 PE=1 SV=1 106 396 7.0E-19
sp|P49063|PGLR2_ARATH Exopolygalacturonase clone GBGA483 OS=Arabidopsis thaliana GN=At3g07850 PE=2 SV=2 208 412 1.0E-18
sp|Q4WX94|PGXC_ASPFU Probable exopolygalacturonase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgxC PE=3 SV=1 3 388 2.0E-18
sp|B0XYC4|PGXC_ASPFC Probable exopolygalacturonase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgxC PE=3 SV=1 3 388 2.0E-18
sp|Q8RY29|ADPG2_ARATH Polygalacturonase ADPG2 OS=Arabidopsis thaliana GN=ADPG2 PE=2 SV=2 107 412 4.0E-18
sp|I1BYN5|RPG14_RHIO9 Exopolygalacturonase rpg14 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg14 PE=1 SV=1 3 408 4.0E-18
sp|Q9P4W2|PGLRD_ASPNG Endopolygalacturonase D OS=Aspergillus niger GN=pgaD PE=3 SV=1 110 395 3.0E-17
sp|A2QTU0|PGLRD_ASPNC Probable endopolygalacturonase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaD PE=3 SV=1 110 395 3.0E-17
sp|I1BPS7|RPG13_RHIO9 Exopolygalacturonase rpg13 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg13 PE=1 SV=1 3 408 3.0E-17
sp|P24548|PGLR_OENOR Exopolygalacturonase (Fragment) OS=Oenothera organensis PE=2 SV=1 156 408 4.0E-17
sp|A1D7I1|PGXC_NEOFI Probable exopolygalacturonase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgxC PE=3 SV=1 3 370 7.0E-17
sp|P35337|PGLR_BRANA Polygalacturonase OS=Brassica napus PE=2 SV=1 104 408 2.0E-16
sp|Q2UQ40|PGXC_ASPOR Probable exopolygalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgxC PE=3 SV=1 21 370 9.0E-16
sp|B8MZZ6|PGXC_ASPFN Probable exopolygalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgxC PE=3 SV=1 21 370 9.0E-16
sp|Q5AYH4|PGLRD_EMENI Probable endopolygalacturonase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaD PE=3 SV=1 110 395 2.0E-15
sp|Q07181|PGLR_GIBFU Polygalacturonase OS=Gibberella fujikuroi GN=PGA PE=1 SV=1 61 372 3.0E-15
sp|A1DBR6|PGLRD_NEOFI Probable endopolygalacturonase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaD PE=3 SV=1 110 400 4.0E-15
sp|Q39766|PGLR_GOSBA Polygalacturonase OS=Gossypium barbadense GN=G9 PE=2 SV=1 151 397 1.0E-14
sp|O59925|PGLR_PENEN Polygalacturonase OS=Penicillium expansum GN=PEPG1 PE=3 SV=1 1 409 1.0E-14
sp|Q9Y833|PGLR2_PENOL Polygalacturonase 2 OS=Penicillium olsonii GN=PG2 PE=3 SV=1 112 408 1.0E-14
sp|Q39786|PGLR_GOSHI Polygalacturonase OS=Gossypium hirsutum GN=G9 PE=2 SV=1 151 397 1.0E-14
sp|Q0CXI3|PGXC_ASPTN Probable exopolygalacturonase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgxC PE=3 SV=1 1 409 2.0E-14
sp|O22818|PGLR6_ARATH Probable polygalacturonase At2g43860 OS=Arabidopsis thaliana GN=At2g43860 PE=2 SV=1 209 409 4.0E-14
sp|Q12554|PGLRC_ASPNG Probable endopolygalacturonase C OS=Aspergillus niger GN=pgaC PE=3 SV=1 9 403 1.0E-13
sp|Q40312|PGLR_MEDSA Polygalacturonase OS=Medicago sativa PE=2 SV=1 159 396 1.0E-13
sp|A2QL39|PGLRC_ASPNC Probable endopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaC PE=3 SV=1 29 403 1.0E-13
sp|Q27UB0|PGXC_ASPNG Exopolygalacturonase C OS=Aspergillus niger GN=pgxC PE=2 SV=1 36 388 1.0E-12
sp|A2QEW2|PGXC_ASPNC Probable exopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgxC PE=3 SV=2 36 388 1.0E-12
sp|P48979|PGLR_PRUPE Polygalacturonase OS=Prunus persica PE=2 SV=1 124 409 2.0E-12
sp|Q8NK99|PGLRA_ASPKW Probable endopolygalacturonase A OS=Aspergillus kawachii (strain NBRC 4308) GN=pgaA PE=3 SV=1 112 408 3.0E-12
sp|Q9P4W4|PGLRA_ASPNG Endopolygalacturonase A OS=Aspergillus niger GN=pgaA PE=1 SV=1 112 408 3.0E-12
sp|A2R8F8|PGLRA_ASPNC Probable endopolygalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaA PE=3 SV=1 112 408 3.0E-12
sp|Q9Y834|PGLR1_PENOL Polygalacturonase 1 OS=Penicillium olsonii GN=PG1 PE=3 SV=1 113 387 4.0E-12
sp|O42824|PGLR_PENJA Polygalacturonase OS=Penicillium janthinellum PE=3 SV=1 112 408 5.0E-12
sp|Q2UT29|PGLRD_ASPOR Probable endopolygalacturonase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgaD PE=3 SV=2 110 400 1.0E-11
sp|Q70HJ3|PGLRC_ASPAC Probable endopolygalacturonase C OS=Aspergillus aculeatus GN=pgaC PE=2 SV=1 112 379 1.0E-11
sp|B8MW78|PGLRD_ASPFN Probable endopolygalacturonase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaD PE=3 SV=1 110 400 1.0E-11
sp|Q9P4W3|PGLRB_ASPNG Endopolygalacturonase B OS=Aspergillus niger GN=pgaB PE=1 SV=1 112 408 1.0E-11
sp|A2QCV8|PGLRB_ASPNC Probable endopolygalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaB PE=3 SV=1 112 408 1.0E-11
sp|Q9P359|PGLR2_ASPAW Endopolygalacturonase II OS=Aspergillus awamori GN=pgaII PE=1 SV=1 112 413 1.0E-11
sp|Q8NK98|PGLR2_ASPKW Probable endopolygalacturonase II OS=Aspergillus kawachii (strain NBRC 4308) GN=pgaII PE=3 SV=2 112 408 2.0E-11
sp|Q5B508|PGLRB_EMENI Endopolygalacturonase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaB PE=1 SV=2 112 408 2.0E-11
sp|Q0CMU3|PGLR1_ASPTN Probable endopolygalacturonase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgaI PE=3 SV=1 112 408 2.0E-11
sp|Q2UFD2|RHGC_ASPOR Probable rhamnogalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rhgC PE=3 SV=1 10 410 3.0E-11
sp|Q9P358|PGLRA_ASPAW Endopolygalacturonase A OS=Aspergillus awamori GN=pgaA PE=1 SV=1 112 408 3.0E-11
sp|Q05967|PGLR_TOBAC Polygalacturonase OS=Nicotiana tabacum GN=PG1 PE=2 SV=1 123 417 3.0E-11
sp|Q1ZZM3|RHGE_ASPNG Probable rhamnogalacturonase E OS=Aspergillus niger GN=rhgE PE=3 SV=1 7 410 5.0E-11
sp|Q1HAY5|PGLRB_ASPKA Probable endopolygalacturonase B OS=Aspergillus kawachii GN=pgaB PE=3 SV=1 112 408 5.0E-11
sp|P19805|PGLR2_ASPTU Endopolygalacturonase II OS=Aspergillus tubingensis GN=pgaII PE=1 SV=1 112 408 5.0E-11
sp|P26215|PGLR_COCCA Polygalacturonase OS=Cochliobolus carbonum GN=PGN1 PE=3 SV=1 112 381 1.0E-10
sp|P49575|PGLRA_ASPPA Probable endopolygalacturonase A OS=Aspergillus parasiticus GN=pgaA PE=2 SV=1 112 408 1.0E-10
sp|P26213|PGLR1_ASPNG Endopolygalacturonase I OS=Aspergillus niger GN=pgaI PE=1 SV=1 114 408 2.0E-10
sp|A2QAH3|PGLR1_ASPNC Probable endopolygalacturonase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaI PE=3 SV=1 114 408 2.0E-10
sp|P26214|PGLR2_ASPNG Endopolygalacturonase II OS=Aspergillus niger GN=pgaII PE=1 SV=1 112 408 2.0E-10
sp|A2R5S4|PGLR2_ASPNC Probable endopolygalacturonase II OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaII PE=3 SV=1 112 408 2.0E-10
sp|B8NGP8|RHGC_ASPFN Probable rhamnogalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rhgC PE=3 SV=2 10 410 3.0E-10
sp|Q4WQT2|PGLRA_ASPFU Probable endopolygalacturonase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaA PE=3 SV=1 114 408 3.0E-10
sp|B0Y4Z4|PGLRA_ASPFC Probable endopolygalacturonase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaA PE=3 SV=1 114 408 3.0E-10
sp|Q70HJ4|PGLR2_ASPAC Probable endopolygalacturonase II OS=Aspergillus aculeatus GN=pgaII PE=2 SV=1 114 408 3.0E-10
sp|Q5ATQ3|PGLR_EMENI Endopolygalacturonase AN8327 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN8327 PE=1 SV=1 112 413 3.0E-10
sp|O42809|PGLRE_ASPNG Endopolygalacturonase E OS=Aspergillus niger GN=pgaE PE=1 SV=1 112 408 5.0E-10
sp|A1CVV8|PGLRA_NEOFI Probable endopolygalacturonase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaA PE=3 SV=1 114 408 6.0E-10
sp|B8N7Z8|PGLRB_ASPFN Probable endopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaB PE=3 SV=1 112 408 7.0E-10
sp|P35335|PGLRB_ASPOR Endopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgaB PE=2 SV=2 112 408 8.0E-10
sp|P41749|PGLRA_ASPFL Endopolygalacturonase A OS=Aspergillus flavus GN=pgaA PE=2 SV=1 112 408 1.0E-09
sp|P87160|RHGA_ASPNG Rhamnogalacturonase A OS=Aspergillus niger GN=rhgA PE=1 SV=1 10 410 2.0E-09
sp|Q9Y718|PGLR_PENDI Polygalacturonase OS=Penicillium digitatum GN=PG1 PE=3 SV=1 113 372 2.0E-09
sp|Q2UHL4|PGLR1_ASPOR Endopolygalacturonase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgaI PE=1 SV=1 127 408 2.0E-09
sp|B8N8M2|PGLR1_ASPFN Probable endopolygalacturonase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaI PE=3 SV=1 127 408 2.0E-09
sp|A2QBB6|PGLRE_ASPNC Probable endopolygalacturonase E OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaE PE=3 SV=1 112 408 2.0E-09
sp|Q5ARE6|RHGA_EMENI Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhgA PE=2 SV=2 211 409 2.0E-09
sp|Q4WBE1|PGLRB_ASPFU Probable endopolygalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaB PE=3 SV=1 112 379 3.0E-09
sp|B0YAH0|PGLRB_ASPFC Probable endopolygalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaB PE=3 SV=1 112 379 3.0E-09
sp|O93883|PGLR_PENGR Polygalacturonase OS=Penicillium griseoroseum GN=PGG1 PE=3 SV=1 47 387 3.0E-09
sp|A2QYE5|RHGA_ASPNC Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rhgA PE=3 SV=1 10 410 3.0E-09
sp|A1DAQ2|PGLRB_NEOFI Probable endopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaB PE=3 SV=1 113 379 4.0E-09
sp|Q00446|PGLR1_COLLN Endopolygalacturonase 1 OS=Colletotrichum lindemuthianum GN=PG1 PE=3 SV=1 113 296 1.0E-08
sp|Q12708|PGLR1_SCLSC Endo-polygalacturonase OS=Sclerotinia sclerotiorum GN=PG1 PE=3 SV=1 112 384 3.0E-08
sp|O74213|PGLR1_ASPAC Endopolygalacturonase I OS=Aspergillus aculeatus GN=pgaI PE=1 SV=1 112 269 4.0E-08
sp|P47180|PGLR_YEAST Polygalacturonase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PGU1 PE=1 SV=1 112 372 1.0E-07
sp|Q2U293|RHGA_ASPOR Probable rhamnogalacturonase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rhgA PE=3 SV=1 211 408 3.0E-07
sp|B8NK45|RHGA_ASPFN Probable rhamnogalacturonase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rhgA PE=3 SV=1 211 408 3.0E-07
sp|B0Y0Q3|RHGB_ASPFC Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rhgB PE=3 SV=1 211 410 5.0E-07
sp|A2QLQ5|RHGC_ASPNC Probable rhamnogalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rhgC PE=3 SV=1 11 410 5.0E-07
sp|Q4WV23|RHGB_ASPFU Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rhgB PE=3 SV=1 211 410 5.0E-07
sp|P87161|RHGB_ASPNG Rhamnogalacturonase B OS=Aspergillus niger GN=rhgB PE=1 SV=1 211 410 6.0E-07
sp|Q00001|RHGA_ASPAC Rhamnogalacturonase A OS=Aspergillus aculeatus GN=rhgA PE=1 SV=1 211 410 8.0E-07
sp|B8NKB9|RHGE_ASPFN Probable rhamnogalacturonase E OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rhgE PE=3 SV=2 228 409 2.0E-06
sp|A1D145|PGLR_NEOFI Probable endopolygalacturonase NFIA_008150 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_008150 PE=3 SV=1 112 413 3.0E-06
sp|A2R3G4|RHGB_ASPNC Probable rhamnogalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rhgB PE=3 SV=1 211 410 3.0E-06
sp|A2QWT2|RHGD_ASPNC Putative rhamnogalacturonase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rhgD PE=3 SV=1 223 419 4.0E-06
sp|A1DED1|RHGB_NEOFI Probable rhamnogalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rhgB PE=3 SV=1 211 410 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004650 polygalacturonase activity Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|117170
MALMKWITLALGALILTVTGAEGKKCRLHPLGSGMDDTDQVEAAINACGHSGTITFEKGMFNITRRMMWDLDNAH
VDLKGTLSFQPDTDYWLNKSNTFQVVFIQSQSSWFVVTGKNFVIDGHGAGGINGNGQAWWNLFATTRPRLDGDGR
PIAFTLWRVSNAVIRGFNVQSPPFWAHTVAESADVLYENILVNATNTDPTFSGQNIVWNTDGINTYRSSRITMRN
WDVTSGDDCIAIKGNSTRITARNFICRGGEGVAFGSLGQYANMTDLVSDILIENVQVLRLPSDVQPNNVHGIYFK
TWDGSLNNGEPPTGGGGGSGLVKNAVFRNFKLDRVDTAVQIIQDFGGGGVIGSRVKLQDMRFENIRGTTNDSTII
NLACSQAVGCSDLVFKNFNVRNPEGADEYICENAHHISGLKGDCH*
Coding >AgabiH97|117170
ATGGCACTCATGAAGTGGATTACTCTTGCATTGGGGGCACTGATACTTACAGTGACCGGCGCCGAGGGAAAGAAA
TGCAGATTACATCCTCTAGGGTCTGGAATGGACGATACTGATCAGGTTGAAGCCGCTATCAACGCATGCGGACAT
TCTGGGACTATCACCTTTGAAAAAGGAATGTTCAACATCACCAGGAGGATGATGTGGGACCTTGATAATGCGCAT
GTTGACCTCAAGGGGACATTGAGTTTCCAACCTGATACAGATTACTGGCTTAACAAGAGCAACACATTCCAAGTC
GTTTTCATTCAGAGTCAATCCTCGTGGTTTGTTGTAACAGGCAAGAATTTTGTGATCGATGGACACGGTGCTGGA
GGTATAAATGGAAATGGCCAGGCTTGGTGGAACCTTTTTGCAACTACACGTCCCCGACTCGACGGCGATGGCCGA
CCTATTGCATTCACTCTGTGGAGAGTCAGTAATGCAGTGATTCGCGGGTTTAATGTTCAAAGTCCTCCGTTTTGG
GCACACACGGTTGCTGAATCCGCGGATGTTTTGTACGAGAATATCCTGGTCAATGCCACCAATACTGACCCAACT
TTCTCTGGCCAAAATATCGTATGGAATACTGACGGCATCAACACTTACAGAAGTTCTCGCATAACGATGCGTAAC
TGGGATGTTACCAGTGGAGACGATTGCATTGCGATCAAGGGCAATTCCACTAGGATAACAGCCCGAAACTTTATT
TGTCGTGGCGGCGAAGGCGTTGCTTTTGGATCTTTGGGCCAATACGCCAACATGACAGATCTAGTTTCTGATATC
CTTATTGAGAACGTGCAGGTGCTGCGTCTTCCCTCCGACGTACAGCCGAACAATGTACATGGTATTTACTTCAAA
ACTTGGGATGGGTCTCTGAACAACGGCGAACCACCGACCGGAGGAGGCGGAGGCTCAGGACTTGTAAAGAATGCT
GTTTTCCGGAATTTCAAGTTGGATCGGGTCGACACTGCTGTTCAAATCATACAAGATTTTGGAGGCGGCGGAGTC
ATCGGTTCCCGTGTCAAACTCCAGGATATGCGGTTTGAGAATATTAGGGGCACTACAAACGACTCTACAATCATA
AATCTCGCGTGTAGTCAAGCAGTTGGATGCTCTGACTTGGTTTTCAAGAACTTTAATGTTCGTAATCCAGAAGGC
GCAGATGAGTACATCTGTGAAAATGCTCACCATATATCAGGTTTAAAAGGCGACTGCCATTAA
Transcript >AgabiH97|117170
ATGGCACTCATGAAGTGGATTACTCTTGCATTGGGGGCACTGATACTTACAGTGACCGGCGCCGAGGGAAAGAAA
TGCAGATTACATCCTCTAGGGTCTGGAATGGACGATACTGATCAGGTTGAAGCCGCTATCAACGCATGCGGACAT
TCTGGGACTATCACCTTTGAAAAAGGAATGTTCAACATCACCAGGAGGATGATGTGGGACCTTGATAATGCGCAT
GTTGACCTCAAGGGGACATTGAGTTTCCAACCTGATACAGATTACTGGCTTAACAAGAGCAACACATTCCAAGTC
GTTTTCATTCAGAGTCAATCCTCGTGGTTTGTTGTAACAGGCAAGAATTTTGTGATCGATGGACACGGTGCTGGA
GGTATAAATGGAAATGGCCAGGCTTGGTGGAACCTTTTTGCAACTACACGTCCCCGACTCGACGGCGATGGCCGA
CCTATTGCATTCACTCTGTGGAGAGTCAGTAATGCAGTGATTCGCGGGTTTAATGTTCAAAGTCCTCCGTTTTGG
GCACACACGGTTGCTGAATCCGCGGATGTTTTGTACGAGAATATCCTGGTCAATGCCACCAATACTGACCCAACT
TTCTCTGGCCAAAATATCGTATGGAATACTGACGGCATCAACACTTACAGAAGTTCTCGCATAACGATGCGTAAC
TGGGATGTTACCAGTGGAGACGATTGCATTGCGATCAAGGGCAATTCCACTAGGATAACAGCCCGAAACTTTATT
TGTCGTGGCGGCGAAGGCGTTGCTTTTGGATCTTTGGGCCAATACGCCAACATGACAGATCTAGTTTCTGATATC
CTTATTGAGAACGTGCAGGTGCTGCGTCTTCCCTCCGACGTACAGCCGAACAATGTACATGGTATTTACTTCAAA
ACTTGGGATGGGTCTCTGAACAACGGCGAACCACCGACCGGAGGAGGCGGAGGCTCAGGACTTGTAAAGAATGCT
GTTTTCCGGAATTTCAAGTTGGATCGGGTCGACACTGCTGTTCAAATCATACAAGATTTTGGAGGCGGCGGAGTC
ATCGGTTCCCGTGTCAAACTCCAGGATATGCGGTTTGAGAATATTAGGGGCACTACAAACGACTCTACAATCATA
AATCTCGCGTGTAGTCAAGCAGTTGGATGCTCTGACTTGGTTTTCAAGAACTTTAATGTTCGTAATCCAGAAGGC
GCAGATGAGTACATCTGTGAAAATGCTCACCATATATCAGGTTTAAAAGGCGACTGCCATTAA
Gene >AgabiH97|117170
ATGGCACTCATGAAGTGGATTACTCTTGCATTGGGGGCACTGATACTTACAGTGACCGGCGCCGAGGGAAAGAAA
TGCAGATTACATCCTCTAGGGTCTGGAATGGACGATACTGATCAGGTAAATTTTTTCCAAAAATCAGTGCTCGAT
ATGATTACGAGGAATTGTGTAGGTTGAAGCCGCTATCAACGCATGCGGACATTCTGGGACTATCACCTTTGAAAA
AGGAATGTTCAACATCACCAGGTTGGTTCTGTGATCTGTCTGGGAGACTTATTTTCACGACATACTGTTATAAAT
TCTCACTTATTAAGGAGGATGATGTGGGACCTTGATAATGCGCATGTTGACCTCAAGGGGACATTGAGTGTAAGT
GTACGTATCCCGACTCAAACTTTCATGACTCAGTTCCTCCATCAGTTCCAACCTGATACAGATTACTGGCTTAAC
AAGAGCAACACATTCCAAGTCGTTTTCATTCAGGTCTGTTCAAGCTAGTTGACAAAATACAAGACTGATAAGGAA
GTTTAGAGTCAATCCTCGTGGTTTGTTGTAACAGGCAAGAATTTTGTGATCGATGGACACGGTGCTGGAGGTATA
AATGGAAATGGCCAGGTCGGGTGCACTCTTTTTTTTCTTGTGAATCTGGGTTTAATGGGCGGCATAGGCTTGGTG
GAACCTTTTTGCAACTACACGTCCCCGACTCGACGGCGATGGCCGACCTATTGCATTCACTCTGTGGAGAGTCAG
TAATGCAGTGATTCGCGGGTTTAATGTTCAAAGTCCTCCGTTTTGGGCACACACGGTTGCTGAATCCGCGGATGT
TTTGTACGAGAATATCCTGGTCAATGCCACCAATACTGACCCAACTTTCTCTGGCCAAAAGTATGAAACACTGGT
TTACTTTCCAACTCAATCAGAATTAATCCTCTTTACAGTATCGTATGGAATACTGACGGTGGGGTTTCAGAGTCG
CTAAGCCTGTACAGAGATATCGAGTGCATGAACGTTTCTAGGCATCAACACTTACAGAAGTTCTCGCATAACGAT
GCGTAACTGGGATGTTACCAGTGGAGACGATTGCATTGCGATCAAGGGCGTAAGTTGCCTCATATATCTCCTTCC
TTTGCCAGTCATTCATCGAAATGCGTCAAGAATTCCACTAGGATAACAGCCCGAAACTTTATTTGTCGTGGCGGC
GAAGGCGTTGCTTTTGGATCTTTGGGCCAATACGCCAACATGGTGGGTCCTTGTCCAACTCGTCTTAGGGTACTC
TGACACTCTCGATGTAGACAGATCTAGTTTCTGATATCCTTATTGAGAACGTGCAGGTACAGTTGCACTTCCTAG
CGCAGTGGTACGGCACAACTCAATTTAACTACCCTTATTAGGTGCTGCGTCTTCCCTCCGACGTACAGCCGAACA
ATGTACATGGTGTAAGTCGATCTGTTTGAAGAGTAAACACATTGATGTATCCGCATCAGATTTACTTCAAAACTT
GGGATGGGTCTCTGAACAACGGCGAACCACCGACCGGAGGAGGCGGAGGCTCAGGTAAGCATAGTATTCAAGATG
AAACCGTTTTTATCGAAGTTATGATTAGGACTTGTAAAGAATGCTGTTTTCCGGAATTTCAAGTTGGATCGGGTC
GACACTGCTGTTCAAATCATACAAGATTTTGGAGGCGGGTCAGTATTTGAAATTTTAGTTTGCGCGAGTTTCGCT
CATATTATCAAGCGGAGTCATCGGTTCCCGTGTCAAACTCCAGGATATGCGGTTTGAGAATATTAGGGGCACTAC
AAACGACTCTACAAGTGCGACACGCTCTTCATTAACTCTGGAGAATTTACTGATTACGTTTATAGTCATAAATCT
CGCGTGTAGTCAAGCAGTTGGATGCTCTGACTTGGTTTTCAAGAACTTTAATGTTCGTAATCCAGAAGGCGCAGA
TGAGTACATCTGTGAAAATGCTCACCATATATCAGGTTTAAAAGGCGAGTTTTCCTAAAATAGAACAATCTCCCA
GTGTGATAGCTCAACATTTCTGCTTTCGTTAGGCGACTGCCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail