Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|116930
Gene name
Locationscaffold_9:864283..865702
Strand+
Gene length (bp)1419
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00734 CBM_1 Fungal cellulose binding domain 4.4E-12 23 50

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 5 455 0.0E+00
sp|G2QJR6|CIP2_MYCTT 4-O-methyl-glucuronoyl methylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=ge2 PE=1 SV=1 86 435 8.0E-132
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 8 56 7.0E-13
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 8 56 7.0E-13
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 8 56 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 5 455 0.0E+00
sp|G2QJR6|CIP2_MYCTT 4-O-methyl-glucuronoyl methylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=ge2 PE=1 SV=1 86 435 8.0E-132
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 8 56 7.0E-13
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 8 56 7.0E-13
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 8 56 1.0E-12
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 6 86 2.0E-12
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 9 71 7.0E-12
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 18 84 9.0E-12
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 3 118 1.0E-09
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 14 55 2.0E-09
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 6 66 2.0E-09
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 18 80 2.0E-09
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 18 55 4.0E-09
sp|A2QYR9|CBHC_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 5 57 4.0E-09
sp|Q5B2E8|CBHC_EMENI 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 1 57 6.0E-09
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 23 54 9.0E-09
sp|A1CCN4|CBHC_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhC PE=3 SV=1 18 56 1.0E-08
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 9 85 4.0E-08
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 9 77 5.0E-08
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 9 77 5.0E-08
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 18 104 5.0E-08
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 4 55 7.0E-08
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 23 54 1.0E-07
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 4 56 2.0E-07
sp|P46236|GUNB_FUSOX Putative endoglucanase type B OS=Fusarium oxysporum PE=2 SV=1 22 107 2.0E-07
sp|B2ABX7|CEL6A_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 23 62 3.0E-07
sp|A1DBV1|MANF_NEOFI Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manF PE=3 SV=1 9 65 3.0E-07
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 9 55 3.0E-07
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 9 55 3.0E-07
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 18 54 4.0E-07
sp|P62695|GUX1_TRIKO Exoglucanase 1 OS=Trichoderma koningii GN=cbh1 PE=3 SV=1 20 54 5.0E-07
sp|P62694|GUX1_HYPJE Exoglucanase 1 OS=Hypocrea jecorina GN=cbh1 PE=1 SV=1 20 54 5.0E-07
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 22 56 1.0E-06
sp|P19355|GUX1_HYPRU Exoglucanase 1 OS=Hypocrea rufa GN=cbh1 PE=3 SV=2 20 54 1.0E-06
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 21 54 2.0E-06
sp|Q9UVS8|CBHB_ASPNG 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger GN=cbhB PE=2 SV=1 21 54 3.0E-06
sp|A2QAI7|CBHB_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhB PE=3 SV=1 21 54 3.0E-06
sp|G4MM92|CEL6A_MAGO7 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel6A PE=1 SV=1 23 56 4.0E-06
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 20 54 4.0E-06
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 23 54 4.0E-06
sp|P13860|GUX1_PHACH Exoglucanase 1 OS=Phanerochaete chrysosporium GN=CBH1 PE=2 SV=1 23 53 5.0E-06
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 20 54 5.0E-06
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 15 54 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030248 cellulose binding Yes
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0030247 polysaccharide binding No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0044238 primary metabolic process No
GO:0030246 carbohydrate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|116930
MAFKQYFFALVLALPAFAQQQTWGQCGGMGWSGQTTCVSGTSCVVINPFYSQCIPGGPPSTTTPPTTTPPTTTPP
TSSDPPTSTDCPTTPSNLSFSNTFLPDPFTFADGQTKVTTKAQWNCRRAELSKLLQQYELGTLPPKPSSVTGSLN
GNTLSVSVSEGGKSISFSATITRPSGATAPYPAIIGVGGINIPAPAGVAVINFNNNDIALQTDGSSRGRGKFYDL
YGSNHSAGAMIAWAWGISRIIDVLEMVGSQSQIDLSKLAVSGCSRNGKGALVAGAFDERIALTIPQESGSGGGGC
WRISDDMLHSGIETQTASEIVGENVWFSPNFNQWANRVNNLPFDHHLLAALVAPRALLVIDNTSIDWLGPRSVWG
CMSTANKVWQALGVADSMGVSQVGNHNHCAFPSNERPDLDAYINKFLKGQSTNTGFLKTDGGGSGFVESRWVNWQ
VPRLS*
Coding >AgabiH97|116930
ATGGCGTTCAAGCAGTATTTCTTCGCCCTTGTCCTGGCCCTTCCTGCTTTTGCCCAACAGCAGACTTGGGGACAG
TGCGGTGGAATGGGCTGGAGTGGTCAAACCACGTGTGTCTCTGGGACATCATGCGTTGTTATCAACCCATTTTAC
TCCCAATGTATTCCTGGAGGACCACCTTCAACGACCACGCCCCCTACCACGACTCCTCCCACTACCACACCCCCG
ACTTCGTCAGACCCGCCAACATCGACAGACTGCCCCACGACACCATCGAACCTTTCTTTCTCTAACACGTTCCTT
CCAGATCCTTTCACTTTTGCCGACGGTCAGACGAAAGTGACTACAAAGGCTCAATGGAATTGCCGTCGTGCGGAA
TTGTCTAAGCTTCTCCAGCAGTACGAGCTAGGTACCCTTCCTCCTAAACCATCCAGTGTGACTGGGTCCTTGAAC
GGCAATACCCTGTCCGTCAGCGTCTCGGAGGGCGGAAAATCCATTTCTTTCTCTGCTACTATCACCCGCCCATCC
GGCGCTACTGCCCCATACCCCGCCATTATTGGGGTTGGTGGTATCAACATTCCCGCACCTGCTGGCGTTGCTGTC
ATTAACTTCAACAACAACGACATTGCTTTGCAGACTGATGGTAGTAGCCGAGGTCGAGGAAAATTCTACGACCTT
TATGGTTCTAATCACTCTGCCGGGGCAATGATAGCCTGGGCTTGGGGTATCTCTCGAATCATTGATGTCCTTGAA
ATGGTTGGCTCTCAGTCTCAGATTGACTTGAGCAAGCTCGCCGTCTCGGGTTGTTCTAGGAATGGCAAGGGCGCT
TTGGTCGCTGGTGCTTTTGATGAACGTATCGCTTTGACGATCCCTCAGGAGTCTGGCTCTGGTGGAGGTGGATGT
TGGCGTATTTCTGATGATATGCTTCATTCCGGAATCGAAACGCAGACCGCTTCGGAAATTGTGGGCGAGAATGTT
TGGTTCTCGCCGAACTTTAACCAATGGGCCAACCGAGTTAACAACCTTCCCTTTGATCACCACTTACTCGCTGCG
CTTGTTGCCCCTCGTGCCTTGCTTGTCATTGACAACACCAGCATTGACTGGCTCGGTCCTCGTAGTGTTTGGGGA
TGCATGAGTACAGCCAACAAGGTCTGGCAAGCCCTCGGAGTTGCAGATTCGATGGGCGTCAGCCAAGTTGGAAAC
CATAATCACTGCGCATTCCCCAGCAACGAGCGGCCGGACTTGGACGCCTATATCAATAAGTTCTTGAAGGGCCAG
AGCACGAATACGGGTTTCCTTAAGACGGATGGCGGAGGATCTGGATTTGTGGAATCAAGATGGGTCAACTGGCAA
GTTCCTAGGTTATCTTGA
Transcript >AgabiH97|116930
ATGGCGTTCAAGCAGTATTTCTTCGCCCTTGTCCTGGCCCTTCCTGCTTTTGCCCAACAGCAGACTTGGGGACAG
TGCGGTGGAATGGGCTGGAGTGGTCAAACCACGTGTGTCTCTGGGACATCATGCGTTGTTATCAACCCATTTTAC
TCCCAATGTATTCCTGGAGGACCACCTTCAACGACCACGCCCCCTACCACGACTCCTCCCACTACCACACCCCCG
ACTTCGTCAGACCCGCCAACATCGACAGACTGCCCCACGACACCATCGAACCTTTCTTTCTCTAACACGTTCCTT
CCAGATCCTTTCACTTTTGCCGACGGTCAGACGAAAGTGACTACAAAGGCTCAATGGAATTGCCGTCGTGCGGAA
TTGTCTAAGCTTCTCCAGCAGTACGAGCTAGGTACCCTTCCTCCTAAACCATCCAGTGTGACTGGGTCCTTGAAC
GGCAATACCCTGTCCGTCAGCGTCTCGGAGGGCGGAAAATCCATTTCTTTCTCTGCTACTATCACCCGCCCATCC
GGCGCTACTGCCCCATACCCCGCCATTATTGGGGTTGGTGGTATCAACATTCCCGCACCTGCTGGCGTTGCTGTC
ATTAACTTCAACAACAACGACATTGCTTTGCAGACTGATGGTAGTAGCCGAGGTCGAGGAAAATTCTACGACCTT
TATGGTTCTAATCACTCTGCCGGGGCAATGATAGCCTGGGCTTGGGGTATCTCTCGAATCATTGATGTCCTTGAA
ATGGTTGGCTCTCAGTCTCAGATTGACTTGAGCAAGCTCGCCGTCTCGGGTTGTTCTAGGAATGGCAAGGGCGCT
TTGGTCGCTGGTGCTTTTGATGAACGTATCGCTTTGACGATCCCTCAGGAGTCTGGCTCTGGTGGAGGTGGATGT
TGGCGTATTTCTGATGATATGCTTCATTCCGGAATCGAAACGCAGACCGCTTCGGAAATTGTGGGCGAGAATGTT
TGGTTCTCGCCGAACTTTAACCAATGGGCCAACCGAGTTAACAACCTTCCCTTTGATCACCACTTACTCGCTGCG
CTTGTTGCCCCTCGTGCCTTGCTTGTCATTGACAACACCAGCATTGACTGGCTCGGTCCTCGTAGTGTTTGGGGA
TGCATGAGTACAGCCAACAAGGTCTGGCAAGCCCTCGGAGTTGCAGATTCGATGGGCGTCAGCCAAGTTGGAAAC
CATAATCACTGCGCATTCCCCAGCAACGAGCGGCCGGACTTGGACGCCTATATCAATAAGTTCTTGAAGGGCCAG
AGCACGAATACGGGTTTCCTTAAGACGGATGGCGGAGGATCTGGATTTGTGGAATCAAGATGGGTCAACTGGCAA
GTTCCTAGGTTATCTTGA
Gene >AgabiH97|116930
ATGGCGTTCAAGCAGTATTTCTTCGCCCTTGTCCTGGCCCTTCCTGCTTTTGCCCAACAGCAGACTTGGGGACAG
TGTACGTTGATAATTCACTTTGATGAAGCTCATATTCATTAACCTTTACTAGGCGGTGGAATGGGCTGGAGTGGT
CAAACCACGTGTGTCTCTGGGACATCATGCGTTGTTATCAACCCATTTTACTCCCAATGTATTCCTGGAGGACCA
CCTTCAACGACCACGCCCCCTACCACGACTCCTCCCACTACCACACCCCCGACTTCGTCAGACCCGCCAACATCG
ACAGACTGCCCCACGACACCATCGAACCTTTCTTTCTCTAACACGTTCCTTCCAGATCCTTTCACTTTTGCCGAC
GGTCAGACGAAAGTGACTACAAAGGCTCAATGGAATTGCCGTCGTGCGGAATTGTCTAAGCTTCTCCAGCAGTAC
GAGCTAGGTACCCTTCCTCCTAAACCATCCAGTGTGACTGGGTCCTTGAACGGCAATACCCTGTCCGTCAGCGTC
TCGGAGGGCGGAAAATCCATTTCTTTCTCTGCTACTATCACCCGCCCATCCGGCGCTACTGCCCCATACCCCGCC
ATTATTGGGGTTGGTGGTATCAACATTCCCGCACCTGCTGGCGTTGCTGTCATTAACTTCAACAACAACGACATT
GCTTTGCAGACTGATGGTAGTAGCCGAGGTCGAGGAAAATTCTACGACCTTTATGGTTCTAATCACTCTGCCGGG
GCAATGATAGCCTGGGCTTGGGGTATCTCTCGAATCATTGATGTCCTTGAAATGGTTGGCTCTCAGTCTCAGATT
GACTTGAGCAAGCTCGCCGTCTCGGGTTGTTCTAGGAATGGCAAGGGCGCTTTGGTCGCTGGTGCTTTTGATGAA
CGTATCGCTTTGACGATCCCTCAGGAGTCTGGCTCTGGTGGAGGTGGATGTTGGCGTATTTCTGATGATATGCTT
CATTCCGGAATCGAAACGCAGACCGCTTCGGAAATTGTGGGCGAGAATGTTTGGTTCTCGCCGAACTTTAACCAA
TGGGCCAACCGAGTTAACAACCTTCCCTTTGATCACCACTTACTCGCTGCGCTTGTTGCCCCTCGTGCCTTGCTT
GTCATTGACAACACCAGCATTGACTGGCTCGGTCCTCGTAGTGTTTGGGGATGCATGAGTACAGCCAACAAGGTC
TGGCAAGCCCTCGGAGTTGCAGATTCGATGGGCGTCAGCCAAGTTGGAAACCATAATCACTGCGCATTCCCCAGC
AACGAGCGGCCGGACTTGGACGCCTATATCAATAAGTTCTTGAAGGGCCAGAGCACGAATACGGGTTTCCTTAAG
ACGGATGGCGGAGGATCTGGATTTGTGGAATCAAGATGGGTCAACTGGCAAGTTCCTAGGTTATCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail