Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|116780
Gene name
Locationscaffold_9:819482..820577
Strand+
Gene length (bp)1095
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06140 Ifi-6-16 Interferon-induced 6-16 family 2.3E-09 219 292

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 207 229 22
3 231 253 22
4 273 295 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|116780
MKFAYVSIISTVLCATFVGVGASPSIFPPHVGSLLGSIPNVLNPEAHIKKVWQEVERKGPQIADQLLGQITQAHA
DVTPIVNEFKDSISKAISQARKTHDEIQEAIAGKGVTITEISTLLSREVEKIYKDLKDEVDDPLSDDRDQRSRAP
RDRAQLVSQIMEKVGIAYAVVLTGVGVPREVAETQFNDFSSTITPVILISGKIVDKYPFLLDIMIFVMSMLLLPH
LSILRPILILFGFGPLGPIKGSIAAWAQRMFWGGAVASGSWFAILQRLGMTATGSAIGNLLASAGITAMFGRGTQ
GQQDL*
Coding >AgabiH97|116780
ATGAAGTTCGCGTATGTGTCAATAATATCTACTGTCCTATGTGCCACGTTTGTGGGCGTCGGGGCGAGTCCTTCC
ATTTTCCCTCCTCATGTTGGCAGTCTACTCGGTTCTATCCCCAATGTCCTTAACCCCGAAGCTCATATCAAGAAG
GTCTGGCAAGAGGTAGAGAGAAAAGGCCCTCAGATAGCCGACCAACTTCTGGGTCAAATAACCCAAGCACACGCC
GACGTTACGCCCATTGTCAATGAGTTTAAGGATTCCATCAGCAAGGCCATTAGTCAGGCCCGTAAGACTCACGAT
GAAATACAAGAAGCGATAGCCGGGAAGGGTGTCACGATTACGGAGATATCAACATTACTTTCCCGAGAAGTAGAA
AAGATTTACAAAGATTTGAAGGACGAAGTGGACGATCCCTTGTCTGATGACCGTGACCAACGGTCAAGGGCACCA
AGGGATCGTGCACAACTCGTCTCTCAAATCATGGAAAAAGTTGGTATAGCATATGCTGTCGTCTTGACTGGTGTA
GGCGTCCCTAGGGAAGTTGCAGAAACTCAATTCAATGACTTTTCCTCCACGATTACGCCGGTCATCCTCATTTCT
GGCAAAATCGTTGACAAGTATCCTTTCCTTCTCGATATCATGATCTTTGTTATGTCGATGTTACTCCTCCCACAC
TTATCCATATTGCGGCCCATACTTATTTTATTCGGCTTTGGTCCTTTGGGTCCAATCAAAGGTTCTATTGCCGCA
TGGGCACAACGGATGTTCTGGGGTGGCGCTGTCGCGTCAGGTAGCTGGTTTGCCATTCTGCAACGACTCGGGATG
ACTGCAACAGGAAGTGCAATTGGAAATTTACTCGCTAGTGCGGGAATTACTGCAATGTTTGGTCGTGGAACCCAA
GGTCAACAAGACCTATGA
Transcript >AgabiH97|116780
ATGAAGTTCGCGTATGTGTCAATAATATCTACTGTCCTATGTGCCACGTTTGTGGGCGTCGGGGCGAGTCCTTCC
ATTTTCCCTCCTCATGTTGGCAGTCTACTCGGTTCTATCCCCAATGTCCTTAACCCCGAAGCTCATATCAAGAAG
GTCTGGCAAGAGGTAGAGAGAAAAGGCCCTCAGATAGCCGACCAACTTCTGGGTCAAATAACCCAAGCACACGCC
GACGTTACGCCCATTGTCAATGAGTTTAAGGATTCCATCAGCAAGGCCATTAGTCAGGCCCGTAAGACTCACGAT
GAAATACAAGAAGCGATAGCCGGGAAGGGTGTCACGATTACGGAGATATCAACATTACTTTCCCGAGAAGTAGAA
AAGATTTACAAAGATTTGAAGGACGAAGTGGACGATCCCTTGTCTGATGACCGTGACCAACGGTCAAGGGCACCA
AGGGATCGTGCACAACTCGTCTCTCAAATCATGGAAAAAGTTGGTATAGCATATGCTGTCGTCTTGACTGGTGTA
GGCGTCCCTAGGGAAGTTGCAGAAACTCAATTCAATGACTTTTCCTCCACGATTACGCCGGTCATCCTCATTTCT
GGCAAAATCGTTGACAAGTATCCTTTCCTTCTCGATATCATGATCTTTGTTATGTCGATGTTACTCCTCCCACAC
TTATCCATATTGCGGCCCATACTTATTTTATTCGGCTTTGGTCCTTTGGGTCCAATCAAAGGTTCTATTGCCGCA
TGGGCACAACGGATGTTCTGGGGTGGCGCTGTCGCGTCAGGTAGCTGGTTTGCCATTCTGCAACGACTCGGGATG
ACTGCAACAGGAAGTGCAATTGGAAATTTACTCGCTAGTGCGGGAATTACTGCAATGTTTGGTCGTGGAACCCAA
GGTCAACAAGACCTATGA
Gene >AgabiH97|116780
ATGAAGTTCGCGTATGTGTCAATAATATCTACTGTCCTATGTGCCACGTTTGTGGGCGTCGGGGCGAGTCCTTCC
ATTTTCCCTCCTCATGTTGGCAGTCTACTCGGTAAGCGATATCAACCAACGCGCACTGCGAATAATTTTCGTAAT
TACCGATTTTTTGCACAGGTTCTATCCCCAATGTCCTTAACCCCGAAGCTCATATCAAGAAGGTCTGGCAAGAGG
TAGAGAGAAAAGGCCCTCAGATAGCCGACCAACTTCTGGGTCAAATAACCCAAGCACACGCCGACGTTACGCCCA
TTGTCAATGAGTTTAAGGATTCCATCAGCAAGGCCATTAGTCAGGCCCGTAAGACTCACGATGAAATACAAGAAG
CGATAGCCGGGAAGGGTGTCACGATTACGGAGATATCAACATTACTTTCCCGAGAAGTAGAAAAGATTTACAAAG
ATTTGAAGGACGAAGTGGACGATCCCTTGTCTGATGACCGTGACCAACGGTCAAGGGCACCAAGGGATCGTGCAC
AACTCGTCTCTCAAATCATGGAAAAAGTTGGTATAGCATATGCTGTCGTCTTGACTGGTGTAGGCGTCCCTAGGG
AAGTTGCAGAAACTCAATTCAATGACTTTTCCTCCACGATTACGCCGGTCATCCTCATTTCTGGTGAGCTCTTCG
GTCTTTTGTTTCTTGTAATCCTTAAGTTAATATTCTATCATATCGCTATAGGCAAAATCGTTGACAAGTATCCTT
TCCTTCTCGATATCATGATCTTTGTTATGTCGATGTTACTCCTCCCACACTTATCCATATTGCGGCCCATACTTA
TTTTATTCGGCTTTGGTCCTTTGGGTCCAATCAAAGGTGATTTATTTCCGTTGCAGCCTCCCCACCTTCTTACAT
GGATCGTTCGCAGGTTCTATTGCCGCATGGGCACAACGGATGTTCTGGGGTGGCGCTGTCGCGTCAGGTAGCTGG
TTTGCCATTCTGCAACGACTCGGGATGACTGCAACAGGAAGTGCAATTGGAAATTTACTCGCTAGTGCGGGAATT
ACTGCAATGTTTGGTCGTGGAACCCAAGGTCAACAAGACCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail