Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|116720
Gene name
Locationscaffold_9:805815..808674
Strand+
Gene length (bp)2859
Transcript length (bp)1734
Coding sequence length (bp)1734
Protein length (aa) 578

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.2E-30 119 499

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 101 561 5.0E-49
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 80 571 7.0E-46
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 90 543 2.0E-41
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 94 576 1.0E-37
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 99 544 6.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 101 561 5.0E-49
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 80 571 7.0E-46
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 90 543 2.0E-41
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 94 576 1.0E-37
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 99 544 6.0E-36
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 101 526 2.0E-34
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 103 576 4.0E-30
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 81 573 5.0E-27
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 86 526 6.0E-25
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 37 391 4.0E-22
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 96 448 4.0E-22
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 106 422 3.0E-20
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 98 399 2.0E-19
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 30 399 4.0E-19
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 98 556 1.0E-18
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 101 505 7.0E-17
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 103 339 2.0E-15
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 104 389 6.0E-14
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 102 379 6.0E-10
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 91 574 1.0E-09
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 38 557 1.0E-09
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 218 349 4.0E-09
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 97 530 2.0E-08
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 45 362 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 156 178 22
2 193 215 22
3 222 244 22
4 259 278 19
5 291 313 22
6 358 380 22
7 387 409 22
8 424 441 17
9 448 470 22
10 515 537 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|116720
MTLVERRLTISDTILDSPPDQNNVPMARALTGASIKFNSTSSTEIKEVDVSKTPHDQQASDGTLHQSGLGPPQRR
HFFSPLDPTWAEAVHRDAETVQYTPEEERRVRRKIDNRVLPLVIISFLFNQFDRTNVGNAHVIDAFNDNYEITTN
QKWTLALSIFYVGYCTLEMPANGINFLVKPRKLTNPTVLQRHIGANRFFFISLTFWGLSSLSFTYAKGYAALLVL
RVLMGIGEAGYYAGVIYYMSFWYTRSEMALRITLGMTGTVPGALGGLLAFGLVRAHTSVLAGWQFLFLIEAIPTL
IMGTCDLLFLPAFPFTASFLTQREKAIAQARLNCDHKPQSHGGMTGWQGFKAVISDPNAWLFMTIYASFNVGVAT
ISYFLPTLIRDLGFSSINAQGLTVAPYVVGWFMVFIQSWHSDRTRDRGYHIMFSAALSCIGYIILATSVQKSVGA
AYFALFLVVGGNFSLFPLVMSWATNTFSPTSKRGVGTAFIVSISNCISIASPQVYFDSEDNFRKGHAIAAGCLFL
SLLAAFTARTRLNALNKRNKIILQEMAQSDEKRVEDESVEIWDNDPRYVFLT*
Coding >AgabiH97|116720
ATGACCTTGGTGGAAAGAAGGCTGACAATCTCCGATACTATTCTCGACTCACCACCTGACCAAAATAATGTACCC
ATGGCTAGAGCATTGACCGGAGCCAGCATAAAGTTCAACTCCACTAGTTCGACAGAAATTAAAGAGGTTGATGTG
TCCAAAACCCCACACGATCAGCAAGCTTCCGATGGAACATTACATCAGAGTGGATTAGGGCCTCCTCAACGAAGG
CATTTCTTCTCTCCTTTAGACCCGACATGGGCAGAGGCGGTACATCGTGATGCTGAGACTGTGCAATATACTCCA
GAAGAGGAGAGACGCGTTCGGCGCAAGATTGACAACAGGGTTTTACCACTTGTCATCATTAGTTTCCTGTTTAAT
CAATTTGATCGCACAAATGTTGGCAACGCGCACGTCATAGATGCTTTCAACGACAATTATGAAATCACCACGAAT
CAGAAATGGACCCTCGCATTAAGTATTTTCTACGTGGGATACTGCACACTCGAGATGCCTGCTAATGGTATAAAT
TTCTTGGTAAAGCCACGTAAACTGACCAACCCCACAGTCCTGCAGCGACATATTGGAGCAAATAGATTCTTCTTC
ATTTCCTTAACGTTTTGGGGTCTCTCATCCCTTTCTTTTACATACGCCAAAGGTTATGCAGCGCTCTTGGTGTTG
CGCGTACTTATGGGGATCGGAGAAGCAGGCTACTACGCTGGAGTGATCTATTACATGTCGTTCTGGTATACACGG
AGCGAAATGGCCTTACGAATCACTTTGGGAATGACTGGAACCGTTCCAGGAGCTCTTGGTGGCCTACTCGCATTC
GGCTTGGTGCGCGCACATACGTCAGTGCTGGCTGGATGGCAATTCCTTTTCCTTATTGAAGCGATTCCTACGCTA
ATTATGGGAACTTGTGATCTCCTTTTTCTCCCTGCCTTTCCCTTCACTGCCTCTTTTTTAACCCAGCGCGAAAAG
GCGATTGCCCAGGCTAGGTTGAATTGCGATCATAAACCCCAGTCGCATGGTGGGATGACGGGATGGCAAGGGTTC
AAAGCTGTTATATCGGATCCAAACGCCTGGCTTTTCATGACCATCTACGCTAGCTTTAATGTTGGCGTTGCGACG
ATTTCATACTTCTTGCCTACGCTAATTAGAGACCTTGGATTCTCTTCAATCAATGCACAAGGGCTTACGGTCGCA
CCCTATGTGGTAGGCTGGTTTATGGTCTTTATCCAATCCTGGCATAGCGATCGTACTCGAGACCGGGGATACCAC
ATCATGTTCTCAGCCGCGCTGTCTTGTATCGGTTATATCATCCTTGCAACCTCTGTACAGAAAAGTGTCGGTGCT
GCTTACTTTGCATTGTTTCTTGTCGTTGGAGGAAACTTTAGTCTCTTTCCTTTGGTAATGAGTTGGGCTACAAAC
ACCTTTTCTCCTACGTCTAAACGTGGTGTTGGAACGGCGTTTATCGTCTCGATATCCAATTGTATATCTATCGCC
TCACCTCAAGTTTACTTTGACTCCGAGGATAATTTTCGTAAAGGTCATGCGATAGCCGCTGGTTGTCTATTTCTC
TCACTCCTTGCTGCATTTACTGCTCGTACTCGGTTGAACGCGTTAAACAAGAGGAACAAAATAATACTGCAGGAG
ATGGCCCAATCTGATGAAAAAAGAGTGGAAGATGAGAGCGTTGAAATTTGGGATAATGATCCCCGTTATGTATTC
TTAACTTGA
Transcript >AgabiH97|116720
ATGACCTTGGTGGAAAGAAGGCTGACAATCTCCGATACTATTCTCGACTCACCACCTGACCAAAATAATGTACCC
ATGGCTAGAGCATTGACCGGAGCCAGCATAAAGTTCAACTCCACTAGTTCGACAGAAATTAAAGAGGTTGATGTG
TCCAAAACCCCACACGATCAGCAAGCTTCCGATGGAACATTACATCAGAGTGGATTAGGGCCTCCTCAACGAAGG
CATTTCTTCTCTCCTTTAGACCCGACATGGGCAGAGGCGGTACATCGTGATGCTGAGACTGTGCAATATACTCCA
GAAGAGGAGAGACGCGTTCGGCGCAAGATTGACAACAGGGTTTTACCACTTGTCATCATTAGTTTCCTGTTTAAT
CAATTTGATCGCACAAATGTTGGCAACGCGCACGTCATAGATGCTTTCAACGACAATTATGAAATCACCACGAAT
CAGAAATGGACCCTCGCATTAAGTATTTTCTACGTGGGATACTGCACACTCGAGATGCCTGCTAATGGTATAAAT
TTCTTGGTAAAGCCACGTAAACTGACCAACCCCACAGTCCTGCAGCGACATATTGGAGCAAATAGATTCTTCTTC
ATTTCCTTAACGTTTTGGGGTCTCTCATCCCTTTCTTTTACATACGCCAAAGGTTATGCAGCGCTCTTGGTGTTG
CGCGTACTTATGGGGATCGGAGAAGCAGGCTACTACGCTGGAGTGATCTATTACATGTCGTTCTGGTATACACGG
AGCGAAATGGCCTTACGAATCACTTTGGGAATGACTGGAACCGTTCCAGGAGCTCTTGGTGGCCTACTCGCATTC
GGCTTGGTGCGCGCACATACGTCAGTGCTGGCTGGATGGCAATTCCTTTTCCTTATTGAAGCGATTCCTACGCTA
ATTATGGGAACTTGTGATCTCCTTTTTCTCCCTGCCTTTCCCTTCACTGCCTCTTTTTTAACCCAGCGCGAAAAG
GCGATTGCCCAGGCTAGGTTGAATTGCGATCATAAACCCCAGTCGCATGGTGGGATGACGGGATGGCAAGGGTTC
AAAGCTGTTATATCGGATCCAAACGCCTGGCTTTTCATGACCATCTACGCTAGCTTTAATGTTGGCGTTGCGACG
ATTTCATACTTCTTGCCTACGCTAATTAGAGACCTTGGATTCTCTTCAATCAATGCACAAGGGCTTACGGTCGCA
CCCTATGTGGTAGGCTGGTTTATGGTCTTTATCCAATCCTGGCATAGCGATCGTACTCGAGACCGGGGATACCAC
ATCATGTTCTCAGCCGCGCTGTCTTGTATCGGTTATATCATCCTTGCAACCTCTGTACAGAAAAGTGTCGGTGCT
GCTTACTTTGCATTGTTTCTTGTCGTTGGAGGAAACTTTAGTCTCTTTCCTTTGGTAATGAGTTGGGCTACAAAC
ACCTTTTCTCCTACGTCTAAACGTGGTGTTGGAACGGCGTTTATCGTCTCGATATCCAATTGTATATCTATCGCC
TCACCTCAAGTTTACTTTGACTCCGAGGATAATTTTCGTAAAGGTCATGCGATAGCCGCTGGTTGTCTATTTCTC
TCACTCCTTGCTGCATTTACTGCTCGTACTCGGTTGAACGCGTTAAACAAGAGGAACAAAATAATACTGCAGGAG
ATGGCCCAATCTGATGAAAAAAGAGTGGAAGATGAGAGCGTTGAAATTTGGGATAATGATCCCCGTTATGTATTC
TTAACTTGA
Gene >AgabiH97|116720
ATGACCTTGGTGGAAAGAAGGCTGACAATCTCCGATACTATTCTCGACTCACCACCTGACCAAAATAATGTACCC
ATGGCTAGAGCATTGACCGGTCCCGTACACACCACTTTGATCCACTTTGATCACGAGCTTAACGCTCTTCCCACA
GGAGCCAGCATAAAGTTCAACGTGGTCTTACGTTTCCCTCTTACCTTGCCGCCATAATGTCAACCAAGTCCACTA
GTTCGACAGAAATTAAAGAGGTTGATGTGTCCAAAACCCCACACGATCAGCAAGCTTCCGATGGAACATTACATC
AGAGTGGATTAGGGCCTCCTCAACGAAGGCATTTCTTCTCTCCTTTAGACCCGACATGGGCAGAGGCGGTACATC
GTGATGCTGAGACTGTGCAATATACTCCAGAAGAGGAGGTTCGTTTCCAAACCGCTTGATCGCTTTGCTTTGGAA
AATGGGAACTGAGCTCCTTCAAGAGACGCGTTCGGCGCAAGATTGACAACAGGGTTTTACCACTTGTCATCATTA
GGTACGCGTTCTAAATTATTTTTGTGGTGGCAAACATTGACGGCGCAATAGTTTCCTGTGTATGTCAATACGAAG
CTTCTGGCATCTCTAGGAATTTTAACTGACAAACGCAACATACATACTAGTTAATCAATTTGGTGAGATGCCGAG
TCCTTGTTTCTTTCAAAGTGCTTGATCCTAATGGCATCGTAGATCGCACAAATGTGTACGTGTTTCCGAAACCCT
TCACAGATAGATTCTCATGTTCCTACAGTGGCAACGCGCACGTCATAGATGCTTTCAACGACAATTATGTATGTT
TCTTGACAATTATAACTTCAATCTTCGTTGATTCAGTCATCAGGAAATCACCACGAATCAGAAATGGACCCTCGC
ATTAAGTATTTTCTACGTGGGATACTGTAGGTTGCAATTCAGTCACGCATACAATGATTAATGATCATTAGGCAC
ACTCGAGATGCCTGCTAATGGTATAAATTTCTTGGTAAAGCCACGTAAACTGACCAACCCCACAGTCCTGCAGCG
ACATATTGGAGCAAATAGATTGTGAGGTTTTTATATCTATGAATGCTCCTATATATCTAAATCACCTCCTTATCT
CAGCTTCTTCATTTCCTTAACGTTTTGGGGTCTCTCATCCCTTTCTTTTACATACGCCAAAGGTTATGCAGCGCT
CTTGGTGTTGCGGTGCGGAATCTCTCGGTTCTTTCAAGTATCGCATTTCTCAAAATGATAATCTATACAGCGTAC
TTATGGGGATCGGAGAAGCAGGCTACTACGCTGGAGTGATCTATTACATGTCGTTCTGGTATACACGGTGCGCAA
GAATTTGACATTTACTCGAATCTATCGTTCTGAGGTGTTTGTAGGAGCGAAATGGCCTTACGAATCACGTCAGTT
AAGAACCCTCGTCTTCTGGTAACCAATTTTGACAAGTAATTAGTTTGGGAATGACTGGAACCGTTCCAGGAGCTC
TTGGTGTGCGTCGTTTGTTCGGAATTATCACCGTTCGATCTCATTATTGGTGAACAGGGCCTACTCGCATTCGGC
TTGGTGCGCGCACATACGTCAGTGCTGGCTGGGTAAGTACTAGCCTATAAACATAGTCAGACGCTCATGTAATTC
TCAGATGGCAATTCCTTTTCCTTGTAGGCATTTTATATCACTAAGGGCAAGCTTTAAACTCAAAGACTGTCCCAG
ATTGAAGCGATTCCTACGCTAATTATGGGAACTTGTGATCTCCTTTTTCTCCCTGCCTTTCCCTTCACTGCCTCT
TTTTTAACCCAGCGCGAAAAGGCGATTGCCCAGGCTAGGTTGAATTGCGATCATAAACCCCAGTCGCATGGTGGG
ATGACGGGATGGCAAGGGTTCAAAGCTGTTATATCGGATCCAAACGCCTGGCTTTTCATGACCATCTACGCTAGC
TGTATGTGTTTCTCCTTTGAAATTCGTTGAAAATCTGACATTTTTCAAGTTAATGTTGGCGTTGCGACGATTTCA
TACTTCTTGCCTACGGTACGCGCCTCTCCTGAACTATGGGTGCTAGGTTGTATTTCTAATGCTGTCCGTAGCTAA
TTAGAGACCTTGGATTCTCTTCAATCAATGCACAAGGGCTTACGGTCGCACCCTATGTGGTAGGCTGGTTTATGG
TCTTTATCCAATCCTGGCATAGCGATCGTACTCGAGACCGGGGATACCACATCATGTTCTCAGCCGCGCTGTCTT
GTATCGGTTATATCATCCTTGCAACCTCTGTACAGAAAAGTGTCGGTGCTGCTTACTTTGCATTGTTTCTTGTCG
TTGGAGGAAACTTTAGTCTCTTTCCTTTGGTAATGTGAGTGACACTCCGTCATAGTGTGTTTTTAGGGTCATTTT
GCTTATTAATCTATGTAGGAGTTGGGCTACAAACACCTTTTCTCCTACGTCTAAACGTGGTGTTGGAACGGCGTT
TATCGTCTCGATATCCAATTGTATATCTATGTAAGTCAGATGAGTATTTATAGTTTGAATGTTACTCTGACCATC
TGCCTTTTGTACCAGCGCCTCACCTCAAGTTTACTTTGACTCCGAGGATAATTTTCGTAAAGGTCATGCGATAGC
CGCTGGGTATGTGGCGTTACGATCGCCGTCCTTCGTCACCATAACCAACCCGTATTTTCTAGTTGTCTATTTCTC
TCACTCCTTGCTGCATTTACTGCTCGTACTCGGTTGAACGCGTTAAACAAGAGGAACAAAATAATACTGCAGGAG
ATGGCCCAATCTGATGAAAAAAGAGTGGAAGATGAGAGCGTTGAAATTTGGGATAATGATCCCCGTTATGTATTC
TTAACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail