Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|116520
Gene name
Locationscaffold_9:757849..758864
Strand-
Gene length (bp)1015
Transcript length (bp)759
Coding sequence length (bp)759
Protein length (aa) 253

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00314 Thaumatin Thaumatin family 6.2E-73 24 250

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28493|PR5_ARATH Pathogenesis-related protein 5 OS=Arabidopsis thaliana GN=At1g75040 PE=1 SV=1 10 250 3.0E-39
sp|Q9FSG7|TP1A_MALDO Thaumatin-like protein 1a OS=Malus domestica GN=TL1 PE=1 SV=1 3 250 9.0E-39
sp|Q9SMH2|TLP1_CASSA Thaumatin-like protein 1 OS=Castanea sativa GN=TL1 PE=2 SV=1 5 250 1.0E-36
sp|O80327|TLP1_PYRPY Thaumatin-like protein 1 OS=Pyrus pyrifolia GN=TL1 PE=1 SV=1 1 250 3.0E-34
sp|P83332|TLP1_PRUPE Thaumatin-like protein 1 OS=Prunus persica PE=2 SV=1 6 250 6.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28493|PR5_ARATH Pathogenesis-related protein 5 OS=Arabidopsis thaliana GN=At1g75040 PE=1 SV=1 10 250 3.0E-39
sp|Q9FSG7|TP1A_MALDO Thaumatin-like protein 1a OS=Malus domestica GN=TL1 PE=1 SV=1 3 250 9.0E-39
sp|Q9SMH2|TLP1_CASSA Thaumatin-like protein 1 OS=Castanea sativa GN=TL1 PE=2 SV=1 5 250 1.0E-36
sp|O80327|TLP1_PYRPY Thaumatin-like protein 1 OS=Pyrus pyrifolia GN=TL1 PE=1 SV=1 1 250 3.0E-34
sp|P83332|TLP1_PRUPE Thaumatin-like protein 1 OS=Prunus persica PE=2 SV=1 6 250 6.0E-34
sp|P50699|TLPH_ARATH Thaumatin-like protein OS=Arabidopsis thaliana GN=At1g18250 PE=2 SV=2 13 250 2.0E-33
sp|Q53MB8|TLPH_ORYSJ Thaumatin-like protein OS=Oryza sativa subsp. japonica GN=Os11g0706600 PE=2 SV=1 3 251 2.0E-33
sp|P50694|TLP_PRUAV Glucan endo-1,3-beta-glucosidase OS=Prunus avium PE=1 SV=1 3 250 1.0E-32
sp|P83335|TLP2_PRUPE Thaumatin-like protein 2 OS=Prunus persica PE=2 SV=1 17 250 3.0E-32
sp|Q41350|OLP1_SOLLC Osmotin-like protein OS=Solanum lycopersicum PE=1 SV=1 20 249 4.0E-32
sp|P83336|TP1B_MALDO Thaumatin-like protein 1b (Fragment) OS=Malus domestica PE=2 SV=1 29 250 3.0E-31
sp|P50700|OSL3_ARATH Osmotin-like protein OSM34 OS=Arabidopsis thaliana GN=OSM34 PE=2 SV=2 10 250 6.0E-31
sp|P33679|ZEAM_MAIZE Zeamatin OS=Zea mays GN=Zlp PE=1 SV=2 1 250 6.0E-30
sp|G5DC91|TLP1_MANZA Thaumatin-like protein 1 OS=Manilkara zapota GN=TLP1 PE=1 SV=2 19 250 7.0E-29
sp|P81295|PRR3_JUNAS Pathogenesis-related protein OS=Juniperus ashei PE=1 SV=1 9 250 3.0E-28
sp|E3SU11|ALL13_OLEEU Thaumatin-like protein OS=Olea europaea PE=1 SV=1 1 250 7.0E-27
sp|P13046|PRR1_TOBAC Pathogenesis-related protein R major form OS=Nicotiana tabacum PE=1 SV=1 5 250 1.0E-26
sp|P13867|IAAT_MAIZE Alpha-amylase/trypsin inhibitor OS=Zea mays PE=1 SV=1 19 250 3.0E-26
sp|Q01591|TPM1_SOLLC Osmotin-like protein TPM-1 (Fragment) OS=Solanum lycopersicum GN=TPM-1 PE=2 SV=1 10 250 6.0E-26
sp|P07052|PRR2_TOBAC Pathogenesis-related protein R minor form OS=Nicotiana tabacum PE=2 SV=1 5 250 4.0E-25
sp|P50701|OS13_SOLCO Osmotin-like protein OSML13 OS=Solanum commersonii PE=2 SV=1 11 250 4.0E-25
sp|P81370|TLP_ACTDE Thaumatin-like protein OS=Actinidia deliciosa GN=tlp PE=1 SV=2 5 250 4.0E-25
sp|P14170|OSMO_TOBAC Osmotin OS=Nicotiana tabacum GN=AP24 PE=1 SV=2 11 250 5.0E-25
sp|P50702|OS81_SOLCO Osmotin-like protein OSML81 OS=Solanum commersonii PE=2 SV=1 11 250 1.0E-23
sp|P25871|OLPA_TOBAC Osmotin-like protein OS=Nicotiana tabacum GN=OLPA PE=1 SV=1 3 250 1.0E-23
sp|P50703|OS35_SOLCO Osmotin-like protein OSML15 OS=Solanum commersonii PE=2 SV=1 3 250 3.0E-23
sp|P12670|NP24_SOLLC Protein NP24 OS=Solanum lycopersicum PE=1 SV=2 12 250 3.0E-22
sp|P25096|P21_SOYBN Protein P21 OS=Glycine max PE=1 SV=1 20 250 5.0E-21
sp|P02883|THM1_THADA Thaumatin-1 OS=Thaumatococcus daniellii PE=1 SV=1 19 250 2.0E-19
sp|P02884|THM2_THADA Thaumatin-2 OS=Thaumatococcus daniellii PE=1 SV=1 17 250 2.0E-19
sp|P27357|TLP_WHEAT Thaumatin-like protein PWIR2 OS=Triticum aestivum PE=2 SV=1 19 151 2.0E-17
sp|P32937|PR1A_HORVU Pathogenesis-related protein 1A/1B OS=Hordeum vulgare PE=2 SV=1 19 151 3.0E-17
sp|P32938|PR1C_HORVU Pathogenesis-related protein 1C OS=Hordeum vulgare PE=2 SV=1 19 151 3.0E-17
sp|P50696|RST2_AVESA Thaumatin-like pathogenesis-related protein 2 OS=Avena sativa GN=RASTL-2 PE=2 SV=1 19 151 1.0E-14
sp|P50697|RST3_AVESA Thaumatin-like pathogenesis-related protein 3 OS=Avena sativa GN=RASTL-3 PE=2 SV=1 19 148 2.0E-14
sp|P50695|RST1_AVESA Thaumatin-like pathogenesis-related protein 1 OS=Avena sativa GN=RASTL-1 PE=2 SV=1 19 151 4.0E-14
sp|P31110|TLP_ORYSJ Thaumatin-like protein OS=Oryza sativa subsp. japonica GN=Os12g0628600 PE=1 SV=1 17 151 7.0E-14
sp|P50698|RST4_AVESA Thaumatin-like pathogenesis-related protein 4 OS=Avena sativa GN=RASTL-4 PE=2 SV=1 22 151 2.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|116520
MKLQLSVSAVFVSSVAARTFTVFNGCPFTVWPAIFTPQGSPAPDHATGWEAPAFTAVSFFVADNWTSGRIWARRN
CDFSTNPGPNSCLDGGCNGGLVCDPISGTGVPPATVAEWTLSGAGGLDSYDVSLVDGYNLPMRINNNVGCPVPEC
PVDLGPNCPAPLIGPFDSSGFPVGCKSACAANLDGNPTDSANCCSGSHNVPATCPSSGVAFYDYFKSNCPKSYAY
AYDDATSLFSCASNLHADYTVTFCPPP*
Coding >AgabiH97|116520
ATGAAGCTCCAACTCTCTGTTTCCGCTGTATTTGTCTCTTCCGTTGCAGCGCGTACCTTTACGGTCTTCAACGGT
TGTCCATTCACTGTCTGGCCTGCCATATTCACCCCTCAAGGGTCTCCGGCTCCGGACCATGCGACTGGATGGGAA
GCTCCAGCCTTTACAGCAGTGTCTTTCTTTGTCGCTGACAATTGGACCTCTGGTCGTATCTGGGCTCGTCGCAAC
TGCGACTTCAGCACCAATCCGGGCCCAAATTCGTGCCTAGATGGTGGCTGCAATGGTGGTCTTGTCTGTGATCCC
ATTAGCGGTACCGGTGTTCCTCCCGCAACCGTTGCAGAATGGACTCTCAGCGGAGCCGGTGGGCTCGATTCATAC
GACGTATCGCTCGTTGACGGGTACAACCTTCCCATGAGGATAAACAACAACGTAGGCTGCCCGGTACCCGAATGT
CCTGTTGATTTGGGTCCAAATTGCCCCGCACCGCTCATTGGTCCCTTTGATTCTTCTGGATTCCCAGTCGGTTGC
AAGTCCGCCTGCGCTGCCAACCTTGATGGAAACCCAACGGATTCAGCTAACTGTTGTAGCGGCTCACACAACGTC
CCCGCAACTTGTCCTTCTTCCGGAGTCGCCTTCTACGATTATTTCAAATCCAACTGCCCCAAGTCATACGCTTAC
GCTTACGATGATGCCACCTCTCTCTTCAGCTGTGCTTCTAACCTCCACGCCGATTATACTGTCACTTTCTGTCCC
CCTCCCTAA
Transcript >AgabiH97|116520
ATGAAGCTCCAACTCTCTGTTTCCGCTGTATTTGTCTCTTCCGTTGCAGCGCGTACCTTTACGGTCTTCAACGGT
TGTCCATTCACTGTCTGGCCTGCCATATTCACCCCTCAAGGGTCTCCGGCTCCGGACCATGCGACTGGATGGGAA
GCTCCAGCCTTTACAGCAGTGTCTTTCTTTGTCGCTGACAATTGGACCTCTGGTCGTATCTGGGCTCGTCGCAAC
TGCGACTTCAGCACCAATCCGGGCCCAAATTCGTGCCTAGATGGTGGCTGCAATGGTGGTCTTGTCTGTGATCCC
ATTAGCGGTACCGGTGTTCCTCCCGCAACCGTTGCAGAATGGACTCTCAGCGGAGCCGGTGGGCTCGATTCATAC
GACGTATCGCTCGTTGACGGGTACAACCTTCCCATGAGGATAAACAACAACGTAGGCTGCCCGGTACCCGAATGT
CCTGTTGATTTGGGTCCAAATTGCCCCGCACCGCTCATTGGTCCCTTTGATTCTTCTGGATTCCCAGTCGGTTGC
AAGTCCGCCTGCGCTGCCAACCTTGATGGAAACCCAACGGATTCAGCTAACTGTTGTAGCGGCTCACACAACGTC
CCCGCAACTTGTCCTTCTTCCGGAGTCGCCTTCTACGATTATTTCAAATCCAACTGCCCCAAGTCATACGCTTAC
GCTTACGATGATGCCACCTCTCTCTTCAGCTGTGCTTCTAACCTCCACGCCGATTATACTGTCACTTTCTGTCCC
CCTCCCTAA
Gene >AgabiH97|116520
ATGAAGCTCCAACTCTCTGTTTCCGCTGTATTTGTCTCTTCCGTTGCAGCGCGTACCTTTACGGTCTTCAACGGT
TGTCCATTCACTGTCTGGTATGTTCATCCTTTCATGAAGAAATGATTGTTCATTGGTCTTTATATTTGGTCTAGG
CCTGCCGTGAGTGGCAGTAGCATTTGAAAACCTAGCTTTCGTTTACAGGTATCCTTCTGAACTAGATATTCACCC
CTCAAGGGTCTCCGGCTCCGGACCATGCGACTGGATGGGAAGCTCCAGCCTTTACAGCAGTGTCTTTCTTTGTCG
CTGACAATTGGACCTCTGGTCGTATCTGGGCTCGTCGCAACTGCGACTTCAGCACCAATCCGGGCCCAAATTCGT
GCCTAGATGGTGGCTGCAATGGTGGTCTTGTCTGTGATCCCATTAGCGGTACCGGTGTTCCTCCCGCAACCGTTG
CAGAATGGACTCTCAGCGGAGCCGGTGGGCTCGATTCATACGACGGTGAGTCAAAACTCAAGATACGATAACCAA
GGTTTTTTTCTTAATTCGTTCCGTTAGTATCGCTCGTTGACGGGTACAACCTTCCCATGAGGATAAACAACAACG
TAGGCTGCCCGGTACCCGAATGTCCTGTTGATTTGGGTCCAAATTGCCCCGCACCGCTCATTGGTCCCTTTGATT
CTTCTGGATTCCCAGTCGGTTGCAAGTCCGCCTGCGCTGCCAACCTTGATGGAAACCCAAGTACGTTATAGATTA
TGATAATCCTAACATTACAACTCCTGACCTATTTCTTTCTTCCTTTCTTCTTTCTTACAACTCCACAGCGGATTC
AGCTAACTGTTGTAGCGGCTCACACAACGTCCCCGCAACTTGTCCTTCTTCCGGAGTCGCCTTCTACGATTATTT
CAAATCCAACTGCCCCAAGTCATACGCTTACGCTTACGATGATGCCACCTCTCTCTTCAGCTGTGCTTCTAACCT
CCACGCCGATTATACTGTCACTTTCTGTCCCCCTCCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail