Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|116250
Gene name
Locationscaffold_9:675617..679559
Strand-
Gene length (bp)3942
Transcript length (bp)3657
Coding sequence length (bp)3657
Protein length (aa) 1219

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06479 Ribonuc_2-5A Ribonuclease 2-5A 1.8E-44 1086 1213
PF00069 Pkinase Protein kinase domain 3.5E-27 752 946
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.2E-15 752 944
PF01011 PQQ PQQ enzyme repeat 6.6E-05 59 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94537|PPK4_SCHPO Serine/threonine-protein kinase ppk4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk4 PE=3 SV=1 728 1214 5.0E-122
sp|P32361|IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRE1 PE=1 SV=2 677 1213 3.0E-120
sp|Q09499|IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans GN=ire-1 PE=1 SV=2 753 1213 4.0E-89
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 753 1213 2.0E-86
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 753 1213 2.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94537|PPK4_SCHPO Serine/threonine-protein kinase ppk4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk4 PE=3 SV=1 728 1214 5.0E-122
sp|P32361|IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRE1 PE=1 SV=2 677 1213 3.0E-120
sp|Q09499|IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans GN=ire-1 PE=1 SV=2 753 1213 4.0E-89
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 753 1213 2.0E-86
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 753 1213 2.0E-85
sp|Q55GJ2|IREA_DICDI Probable serine/threonine-protein kinase ireA OS=Dictyostelium discoideum GN=ireA PE=3 SV=1 749 1213 3.0E-77
sp|Q9C5S2|IRE1A_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1a OS=Arabidopsis thaliana GN=IRE1A PE=1 SV=1 748 1214 2.0E-76
sp|Q93VJ2|IRE1B_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1b OS=Arabidopsis thaliana GN=IRE1B PE=2 SV=1 748 1212 2.0E-73
sp|Q76MJ5|ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens GN=ERN2 PE=1 SV=4 1000 1218 8.0E-52
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 1000 1213 3.0E-50
sp|Q9SF12|IRE1L_ARATH Inactive serine/threonine-protein kinase/endoribonuclease IRE1-like OS=Arabidopsis thaliana GN=At3g11870 PE=3 SV=1 656 1213 2.0E-49
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 753 944 3.0E-42
sp|Q76MJ5|ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens GN=ERN2 PE=1 SV=4 753 944 2.0E-39
sp|Q55DJ9|IRLD_DICDI Probable serine/threonine-protein kinase irlD OS=Dictyostelium discoideum GN=irlD PE=3 SV=1 754 1200 1.0E-33
sp|Q55DJ8|IRLC_DICDI Probable serine/threonine-protein kinase irlC OS=Dictyostelium discoideum GN=irlC PE=3 SV=1 752 1098 3.0E-33
sp|Q557G1|IRLB_DICDI Probable serine/threonine-protein kinase irlB OS=Dictyostelium discoideum GN=irlB-1 PE=3 SV=1 753 1212 9.0E-32
sp|Q559A2|IRLA_DICDI Probable serine/threonine-protein kinase irlA OS=Dictyostelium discoideum GN=irlA PE=3 SV=1 752 1203 5.0E-30
sp|Q54IE8|IRLE_DICDI Probable serine/threonine-protein kinase irlE OS=Dictyostelium discoideum GN=irlE PE=3 SV=1 753 1093 3.0E-29
sp|Q556Q3|IRLF_DICDI Probable serine/threonine-protein kinase irlF OS=Dictyostelium discoideum GN=irlF-1 PE=3 SV=1 998 1212 2.0E-18
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 754 1080 2.0E-15
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 740 1080 1.0E-14
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 754 1079 5.0E-14
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 753 943 6.0E-13
sp|Q9LX30|GCN2_ARATH Probable serine/threonine-protein kinase GCN2 OS=Arabidopsis thaliana GN=GCN2 PE=2 SV=2 755 1079 1.0E-12
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 755 944 1.0E-12
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 790 1082 2.0E-12
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 755 944 3.0E-12
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 755 944 4.0E-12
sp|Q8IZL9|CDK20_HUMAN Cyclin-dependent kinase 20 OS=Homo sapiens GN=CDK20 PE=1 SV=1 755 962 4.0E-12
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 755 944 6.0E-12
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 750 1079 7.0E-12
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 755 944 7.0E-12
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 771 1079 8.0E-12
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 750 1079 8.0E-12
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 755 944 9.0E-12
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 755 944 9.0E-12
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 755 944 1.0E-11
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 755 950 1.0E-11
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 755 944 1.0E-11
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 755 944 1.0E-11
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 755 944 1.0E-11
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 755 944 1.0E-11
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 755 944 1.0E-11
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 755 944 1.0E-11
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 755 944 1.0E-11
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 755 944 1.0E-11
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 755 945 2.0E-11
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 755 944 2.0E-11
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 742 1080 2.0E-11
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 753 943 2.0E-11
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 727 1080 2.0E-11
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 754 1097 4.0E-11
sp|Q556Q3|IRLF_DICDI Probable serine/threonine-protein kinase irlF OS=Dictyostelium discoideum GN=irlF-1 PE=3 SV=1 753 878 5.0E-11
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 755 945 5.0E-11
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 755 945 5.0E-11
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 755 945 5.0E-11
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 755 945 5.0E-11
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 755 945 7.0E-11
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 710 1084 7.0E-11
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 755 944 8.0E-11
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 755 945 9.0E-11
sp|Q04770|CDK2_ENTHI Cell division protein kinase 2 homolog OS=Entamoeba histolytica GN=CDC2 PE=3 SV=1 755 1080 9.0E-11
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 754 1080 1.0E-10
sp|P0CD62|LIMKB_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0286997 OS=Dictyostelium discoideum GN=DDB_G0286997 PE=3 SV=1 749 945 1.0E-10
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 755 950 1.0E-10
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 755 945 1.0E-10
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 755 945 1.0E-10
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 755 950 1.0E-10
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 755 945 1.0E-10
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 753 946 2.0E-10
sp|Q5UQ78|YR517_MIMIV Putative serine/threonine-protein kinase R517/R518 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R517 PE=3 SV=2 750 946 2.0E-10
sp|Q5R7I7|CDK20_PONAB Cyclin-dependent kinase 20 OS=Pongo abelii GN=CDK20 PE=2 SV=1 755 951 2.0E-10
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 753 1086 2.0E-10
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 755 945 2.0E-10
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 800 1085 2.0E-10
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 755 945 2.0E-10
sp|Q5EAB2|CDK9_BOVIN Cyclin-dependent kinase 9 OS=Bos taurus GN=CDK9 PE=2 SV=1 755 1081 2.0E-10
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 755 945 3.0E-10
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 745 882 3.0E-10
sp|Q641Z4|CDK9_RAT Cyclin-dependent kinase 9 OS=Rattus norvegicus GN=Cdk9 PE=2 SV=1 755 1081 4.0E-10
sp|Q99J95|CDK9_MOUSE Cyclin-dependent kinase 9 OS=Mus musculus GN=Cdk9 PE=1 SV=1 755 1081 4.0E-10
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 800 1085 4.0E-10
sp|Q91618|PMYT1_XENLA Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Xenopus laevis GN=pkmyt1 PE=1 SV=1 755 945 4.0E-10
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 755 945 5.0E-10
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 755 1079 5.0E-10
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 800 1085 6.0E-10
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 800 1085 6.0E-10
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 800 1085 6.0E-10
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 755 948 6.0E-10
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 766 1080 7.0E-10
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 755 945 8.0E-10
sp|Q54TW2|PDPKA_DICDI Probable serine/threonine-protein kinase pdkA OS=Dictyostelium discoideum GN=pdkA PE=3 SV=1 754 881 8.0E-10
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 755 1080 8.0E-10
sp|Q9ESG9|PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus GN=Pkmyt1 PE=2 SV=3 755 945 9.0E-10
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 755 948 9.0E-10
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 754 943 9.0E-10
sp|Q9JHU3|CDK20_MOUSE Cyclin-dependent kinase 20 OS=Mus musculus GN=Cdk20 PE=1 SV=1 755 951 9.0E-10
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 755 948 9.0E-10
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 754 943 9.0E-10
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 755 948 9.0E-10
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 755 943 9.0E-10
sp|Q4KM34|CDK20_RAT Cyclin-dependent kinase 20 OS=Rattus norvegicus GN=Cdk20 PE=2 SV=2 755 951 9.0E-10
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 755 944 1.0E-09
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 752 946 1.0E-09
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 754 943 1.0E-09
sp|P54665|CC2H2_TRYBB Cell division control protein 2 homolog 2 OS=Trypanosoma brucei brucei GN=CRK2 PE=3 SV=1 755 946 1.0E-09
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 755 950 1.0E-09
sp|Q09437|YP62_CAEEL Putative serine/threonine-protein kinase B0495.2 OS=Caenorhabditis elegans GN=B0495.2 PE=3 SV=1 753 945 1.0E-09
sp|Q5ZKN1|CDK9_CHICK Cyclin-dependent kinase 9 OS=Gallus gallus GN=CDK9 PE=2 SV=1 755 1081 1.0E-09
sp|P54685|CDK7_DICDI Cyclin-dependent kinase 7 OS=Dictyostelium discoideum GN=cdk7 PE=2 SV=2 754 1080 1.0E-09
sp|Q869X3|Y9851_DICDI Probable serine/threonine-protein kinase DDB_G0275165 OS=Dictyostelium discoideum GN=DDB_G0275165 PE=3 SV=1 754 946 1.0E-09
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 755 948 1.0E-09
sp|P32361|IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRE1 PE=1 SV=2 51 342 2.0E-09
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 755 946 2.0E-09
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 755 1085 2.0E-09
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 755 943 2.0E-09
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 755 944 2.0E-09
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 755 1082 2.0E-09
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 800 1085 2.0E-09
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 755 1085 2.0E-09
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 800 1085 2.0E-09
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 755 1080 2.0E-09
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 754 1090 2.0E-09
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 753 1124 3.0E-09
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 745 1080 3.0E-09
sp|Q54U31|SHKD_DICDI Dual specificity protein kinase shkD OS=Dictyostelium discoideum GN=shkD PE=3 SV=1 746 945 3.0E-09
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 725 946 3.0E-09
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 754 895 3.0E-09
sp|Q55C57|GLKA_DICDI Probable serine/threonine-protein kinase glkA OS=Dictyostelium discoideum GN=glkA PE=3 SV=1 755 945 3.0E-09
sp|P50750|CDK9_HUMAN Cyclin-dependent kinase 9 OS=Homo sapiens GN=CDK9 PE=1 SV=3 755 1081 3.0E-09
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 754 1079 3.0E-09
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 755 945 3.0E-09
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 764 1080 3.0E-09
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 800 1085 4.0E-09
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 800 1080 4.0E-09
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 800 1085 4.0E-09
sp|Q1RMT8|IRAK4_BOVIN Interleukin-1 receptor-associated kinase 4 OS=Bos taurus GN=IRAK4 PE=2 SV=1 750 947 4.0E-09
sp|Q5EDC3|CDK20_MACMU Cyclin-dependent kinase 20 OS=Macaca mulatta GN=CDK20 PE=2 SV=1 755 918 4.0E-09
sp|Q86AE1|Y9853_DICDI Probable serine/threonine-protein kinase DDB_G0271538 OS=Dictyostelium discoideum GN=DDB_G0271538 PE=3 SV=1 755 945 5.0E-09
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 755 1085 5.0E-09
sp|Q91727|CDK4_XENLA Cyclin-dependent kinase 4 OS=Xenopus laevis GN=cdk4 PE=1 SV=1 755 1089 5.0E-09
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 755 946 5.0E-09
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 755 943 5.0E-09
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 747 953 5.0E-09
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 751 1080 6.0E-09
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 755 944 6.0E-09
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 754 948 6.0E-09
sp|P21965|MCK1_YEAST Protein kinase MCK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCK1 PE=1 SV=1 748 945 6.0E-09
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 771 1086 6.0E-09
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 800 1085 6.0E-09
sp|Q54L00|LIMKA_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0287001 OS=Dictyostelium discoideum GN=DDB_G0287001 PE=3 SV=1 749 945 7.0E-09
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 754 943 7.0E-09
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 754 943 7.0E-09
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 755 944 7.0E-09
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 755 945 7.0E-09
sp|Q00094|KR73_ICHVA Protein kinase ORF73 OS=Ictalurid herpesvirus 1 (strain Auburn) GN=ORF73 PE=3 SV=1 737 899 8.0E-09
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 755 948 8.0E-09
sp|P9WI67|PKNJ_MYCTU Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknJ PE=1 SV=1 752 946 8.0E-09
sp|P9WI66|PKNJ_MYCTO Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknJ PE=1 SV=1 752 946 8.0E-09
sp|P65733|PKNJ_MYCBO Serine/threonine-protein kinase PknJ OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknJ PE=3 SV=1 752 946 8.0E-09
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 755 946 9.0E-09
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 755 943 9.0E-09
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 754 1079 9.0E-09
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 755 895 9.0E-09
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 755 950 9.0E-09
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 755 946 9.0E-09
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 755 945 9.0E-09
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 763 943 1.0E-08
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 754 948 1.0E-08
sp|Q00534|CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1 755 1085 1.0E-08
sp|Q03957|CTK1_YEAST CTD kinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTK1 PE=1 SV=1 687 953 1.0E-08
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 754 945 1.0E-08
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 766 882 1.0E-08
sp|Q1ZXH2|FHKB_DICDI Probable serine/threonine-protein kinase fhkB OS=Dictyostelium discoideum GN=fhkB PE=3 SV=1 755 943 1.0E-08
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 754 945 1.0E-08
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 766 882 1.0E-08
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 754 948 1.0E-08
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 800 944 1.0E-08
sp|Q01917|CDC2H_CRIFA Cell division control protein 2 homolog OS=Crithidia fasciculata GN=CRK PE=3 SV=1 755 883 1.0E-08
sp|Q6GLD8|CDK9_XENTR Cyclin-dependent kinase 9 OS=Xenopus tropicalis GN=cdk9 PE=2 SV=1 755 1081 1.0E-08
sp|Q63572|TESK1_RAT Dual specificity testis-specific protein kinase 1 OS=Rattus norvegicus GN=Tesk1 PE=1 SV=1 789 955 1.0E-08
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 755 948 1.0E-08
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 754 943 1.0E-08
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 752 944 1.0E-08
sp|Q80YP0|CDK3_MOUSE Cyclin-dependent kinase 3 OS=Mus musculus GN=Cdk3 PE=1 SV=2 755 945 2.0E-08
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 755 955 2.0E-08
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 755 1077 2.0E-08
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 755 948 2.0E-08
sp|P93101|CDC2_OXYRB Cell division control protein 2 homolog OS=Oxybasis rubra GN=CDC2 PE=2 SV=1 755 945 2.0E-08
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 755 948 2.0E-08
sp|Q54F40|Y1133_DICDI Probable protein kinase DDB_G0291133 OS=Dictyostelium discoideum GN=DDB_G0291133 PE=3 SV=1 755 917 2.0E-08
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 748 943 2.0E-08
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 755 945 2.0E-08
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 754 944 2.0E-08
sp|P48734|CDK1_BOVIN Cyclin-dependent kinase 1 OS=Bos taurus GN=CDK1 PE=2 SV=2 755 948 2.0E-08
sp|G5ECH7|CDK5_CAEEL Cyclin-dependent-like kinase 5 OS=Caenorhabditis elegans GN=cdk-5 PE=1 SV=1 755 945 2.0E-08
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 755 948 2.0E-08
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 797 946 2.0E-08
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 753 943 2.0E-08
sp|Q9HGY5|PHO85_CANAX Negative regulator of the PHO system OS=Candida albicans GN=PHO85 PE=3 SV=1 755 945 2.0E-08
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 754 948 2.0E-08
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 752 945 2.0E-08
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 735 1116 2.0E-08
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 741 946 2.0E-08
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 755 943 2.0E-08
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 735 1116 2.0E-08
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 735 1116 2.0E-08
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 735 1116 2.0E-08
sp|Q1EBK0|SSN3_COCIM Serine/threonine-protein kinase SSN3 OS=Coccidioides immitis (strain RS) GN=SSN3 PE=3 SV=3 754 945 2.0E-08
sp|O94537|PPK4_SCHPO Serine/threonine-protein kinase ppk4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk4 PE=3 SV=1 56 394 3.0E-08
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 735 1116 3.0E-08
sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 755 945 3.0E-08
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 800 882 3.0E-08
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 777 1077 3.0E-08
sp|Q8QHK8|MK08_XENLA Mitogen-activated protein kinase 8 OS=Xenopus laevis GN=mapk8 PE=2 SV=2 755 1080 3.0E-08
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 754 945 3.0E-08
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 766 882 3.0E-08
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 753 945 3.0E-08
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 753 951 3.0E-08
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 755 1080 3.0E-08
sp|Q9U2Q9|GSK3_CAEEL Glycogen synthase kinase-3 OS=Caenorhabditis elegans GN=gsk-3 PE=1 SV=1 754 957 3.0E-08
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 755 1085 3.0E-08
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 755 943 4.0E-08
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 754 948 4.0E-08
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 755 1080 4.0E-08
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 777 1077 4.0E-08
sp|P39951|CDK1_RAT Cyclin-dependent kinase 1 OS=Rattus norvegicus GN=Cdk1 PE=1 SV=1 755 948 4.0E-08
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 753 943 4.0E-08
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 754 948 4.0E-08
sp|Q10452|GSK3_SCHPO Protein kinase gsk3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk3 PE=1 SV=3 722 957 4.0E-08
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 754 943 4.0E-08
sp|Q751E8|PHO85_ASHGO Negative regulator of the PHO system OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PHO85 PE=3 SV=2 755 945 4.0E-08
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 755 945 4.0E-08
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 755 943 4.0E-08
sp|Q54MY9|MKCA_DICDI Probable serine/threonine-protein kinase mkcA OS=Dictyostelium discoideum GN=mkcA PE=2 SV=1 755 944 4.0E-08
sp|Q54XL6|FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum GN=fray1 PE=3 SV=1 755 1097 4.0E-08
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 800 944 4.0E-08
sp|Q5RCH1|CDK1_PONAB Cyclin-dependent kinase 1 OS=Pongo abelii GN=CDK1 PE=2 SV=1 755 948 4.0E-08
sp|Q55GJ2|IREA_DICDI Probable serine/threonine-protein kinase ireA OS=Dictyostelium discoideum GN=ireA PE=3 SV=1 48 240 5.0E-08
sp|Q8AYK6|WEE1A_XENLA Wee1-like protein kinase 1-A OS=Xenopus laevis GN=wee1-a PE=2 SV=1 755 910 5.0E-08
sp|Q9FPR3|EDR1_ARATH Serine/threonine-protein kinase EDR1 OS=Arabidopsis thaliana GN=EDR1 PE=1 SV=1 744 946 5.0E-08
sp|Q8SRI3|MRK1_ENCCU Probable serine/threonine-protein kinase MRK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MRK1 PE=3 SV=2 754 883 5.0E-08
sp|P49185|MK08_RAT Mitogen-activated protein kinase 8 OS=Rattus norvegicus GN=Mapk8 PE=1 SV=1 755 945 5.0E-08
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 755 945 5.0E-08
sp|Q8QGV2|WEE1B_XENLA Wee1-like protein kinase 1-B OS=Xenopus laevis GN=wee1-b PE=1 SV=1 755 880 6.0E-08
sp|A8X5H5|GSK3_CAEBR Glycogen synthase kinase-3 OS=Caenorhabditis briggsae GN=gsk-3 PE=3 SV=1 754 957 6.0E-08
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 754 943 6.0E-08
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 790 943 6.0E-08
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 755 948 6.0E-08
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 755 948 6.0E-08
sp|A8XA58|CDK1_CAEBR Cyclin-dependent kinase 1 OS=Caenorhabditis briggsae GN=cdk-1 PE=3 SV=1 755 962 6.0E-08
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 790 943 6.0E-08
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 800 1080 6.0E-08
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 800 1080 6.0E-08
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 800 1080 6.0E-08
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 800 1080 6.0E-08
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 754 944 7.0E-08
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 755 946 7.0E-08
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 790 943 7.0E-08
sp|O94737|MAPK1_PNECA Mitogen-activated protein kinase 1 OS=Pneumocystis carinii GN=MKP1 PE=1 SV=1 755 943 7.0E-08
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 703 917 7.0E-08
sp|Q9URT9|GSK31_SCHPO Protein kinase gsk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk31 PE=1 SV=1 754 1085 7.0E-08
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 755 1080 7.0E-08
sp|O70146|TESK1_MOUSE Dual specificity testis-specific protein kinase 1 OS=Mus musculus GN=Tesk1 PE=1 SV=3 789 955 7.0E-08
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 754 943 7.0E-08
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 754 950 7.0E-08
sp|A8WIP6|CDK20_DANRE Cyclin-dependent kinase 20 OS=Danio rerio GN=cdk20 PE=2 SV=1 755 1081 7.0E-08
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 753 881 8.0E-08
sp|P45983|MK08_HUMAN Mitogen-activated protein kinase 8 OS=Homo sapiens GN=MAPK8 PE=1 SV=2 755 945 8.0E-08
sp|Q9V3Q6|M3K7_DROME Mitogen-activated protein kinase kinase kinase 7 OS=Drosophila melanogaster GN=Tak1 PE=2 SV=1 755 945 8.0E-08
sp|Q91Y86|MK08_MOUSE Mitogen-activated protein kinase 8 OS=Mus musculus GN=Mapk8 PE=1 SV=1 755 945 8.0E-08
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 754 943 8.0E-08
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 753 945 9.0E-08
sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa GN=MSK-1 PE=2 SV=1 732 957 9.0E-08
sp|Q76MJ5|ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens GN=ERN2 PE=1 SV=4 58 270 1.0E-07
sp|A4QNA8|WEE2_XENTR Wee1-like protein kinase 2 OS=Xenopus tropicalis GN=wee2 PE=2 SV=1 755 882 1.0E-07
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 755 1080 1.0E-07
sp|P43288|KSG1_ARATH Shaggy-related protein kinase alpha OS=Arabidopsis thaliana GN=ASK1 PE=1 SV=3 695 957 1.0E-07
sp|Q9U9Y8|NLK_CAEEL Serine/threonine kinase NLK OS=Caenorhabditis elegans GN=lit-1 PE=1 SV=1 752 945 1.0E-07
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 754 943 1.0E-07
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 755 1090 1.0E-07
sp|Q23915|KINX_DICDI Probable serine/threonine-protein kinase kinX OS=Dictyostelium discoideum GN=kinX PE=3 SV=2 755 945 1.0E-07
sp|P43289|KSG3_ARATH Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1 703 957 1.0E-07
sp|P47817|WEE2A_XENLA Wee1-like protein kinase 2-A OS=Xenopus laevis GN=wee2-a PE=1 SV=2 755 893 1.0E-07
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 753 883 1.0E-07
sp|Q00646|CDK1_EMENI Cyclin-dependent kinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimX PE=2 SV=1 755 945 1.0E-07
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 754 943 1.0E-07
sp|Q8RY17|WAKLI_ARATH Wall-associated receptor kinase-like 22 OS=Arabidopsis thaliana GN=WAKL22 PE=2 SV=1 752 944 1.0E-07
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 752 946 1.0E-07
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 753 946 1.0E-07
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 800 946 1.0E-07
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 748 943 1.0E-07
sp|P18431|SGG_DROME Protein kinase shaggy OS=Drosophila melanogaster GN=sgg PE=1 SV=3 754 953 2.0E-07
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 764 904 2.0E-07
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 755 1080 2.0E-07
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 753 946 2.0E-07
sp|P49841|GSK3B_HUMAN Glycogen synthase kinase-3 beta OS=Homo sapiens GN=GSK3B PE=1 SV=2 753 957 2.0E-07
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 764 904 2.0E-07
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 729 945 2.0E-07
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 755 944 2.0E-07
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 749 946 2.0E-07
sp|Q9WV60|GSK3B_MOUSE Glycogen synthase kinase-3 beta OS=Mus musculus GN=Gsk3b PE=1 SV=2 753 957 2.0E-07
sp|P23111|CDC2_MAIZE Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1 755 945 2.0E-07
sp|Q5YJC2|GSK3B_SPECI Glycogen synthase kinase-3 beta OS=Spermophilus citellus GN=GSK3B PE=2 SV=1 754 957 2.0E-07
sp|E1BMN8|NLK_BOVIN Serine/threonine-protein kinase NLK OS=Bos taurus GN=NLK PE=3 SV=2 752 945 2.0E-07
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 755 948 2.0E-07
sp|D3ZSZ3|NLK_RAT Serine/threonine-protein kinase NLK OS=Rattus norvegicus GN=Nlk PE=3 SV=1 752 945 2.0E-07
sp|O54949|NLK_MOUSE Serine/threonine-protein kinase NLK OS=Mus musculus GN=Nlk PE=1 SV=2 752 945 2.0E-07
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 754 964 2.0E-07
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 755 955 2.0E-07
sp|Q8NU97|PKN2_CORGL Serine/threonine-protein kinases PknA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknA PE=3 SV=1 754 946 2.0E-07
sp|P41808|SMK1_YEAST Sporulation-specific mitogen-activated protein kinase SMK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMK1 PE=1 SV=1 754 943 2.0E-07
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 752 946 2.0E-07
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 755 1080 2.0E-07
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 698 917 2.0E-07
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 764 904 2.0E-07
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 720 943 2.0E-07
sp|Q9UBE8|NLK_HUMAN Serine/threonine-protein kinase NLK OS=Homo sapiens GN=NLK PE=1 SV=2 752 945 2.0E-07
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 745 946 2.0E-07
sp|P18266|GSK3B_RAT Glycogen synthase kinase-3 beta OS=Rattus norvegicus GN=Gsk3b PE=1 SV=1 753 957 2.0E-07
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 755 1090 2.0E-07
sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homolog MsK-3 OS=Medicago sativa GN=MSK-3 PE=2 SV=2 732 957 2.0E-07
sp|Q91757|GSK3B_XENLA Glycogen synthase kinase-3 beta OS=Xenopus laevis GN=gsk3b PE=1 SV=1 753 957 2.0E-07
sp|E2QWQ2|NLK_CANLF Serine/threonine-protein kinase NLK OS=Canis lupus familiaris GN=NLK PE=3 SV=1 752 945 2.0E-07
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 754 946 2.0E-07
sp|Q61831|MK10_MOUSE Mitogen-activated protein kinase 10 OS=Mus musculus GN=Mapk10 PE=1 SV=2 755 945 2.0E-07
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 755 958 2.0E-07
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 800 1079 2.0E-07
sp|P34556|CDK1_CAEEL Cyclin-dependent kinase 1 OS=Caenorhabditis elegans GN=cdk-1 PE=1 SV=1 755 962 2.0E-07
sp|Q8G6P9|PKNB_BIFLO Probable serine/threonine-protein kinase PknB OS=Bifidobacterium longum (strain NCC 2705) GN=pknB PE=3 SV=1 735 946 2.0E-07
sp|Q9ZVM9|Y1461_ARATH Probable serine/threonine-protein kinase At1g54610 OS=Arabidopsis thaliana GN=At1g54610 PE=1 SV=1 755 945 2.0E-07
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 752 946 2.0E-07
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 59 247 3.0E-07
sp|Q4V862|CDK9A_XENLA Cyclin-dependent kinase 9-A OS=Xenopus laevis GN=cdk9-a PE=2 SV=1 755 1081 3.0E-07
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 755 1098 3.0E-07
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 753 944 3.0E-07
sp|Q8SSH1|Y255_ENCCU Probable serine/threonine-protein kinase ECU02_0550 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0550 PE=3 SV=1 753 946 3.0E-07
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 755 944 3.0E-07
sp|Q9TVL3|CDK9_CAEEL Probable cyclin-dependent kinase 9 OS=Caenorhabditis elegans GN=cdk-9 PE=3 SV=2 753 946 3.0E-07
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 755 943 3.0E-07
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 753 943 3.0E-07
sp|P53779|MK10_HUMAN Mitogen-activated protein kinase 10 OS=Homo sapiens GN=MAPK10 PE=1 SV=2 755 945 3.0E-07
sp|Q8TFG6|PPK18_SCHPO Serine/threonine-protein kinase ppk18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk18 PE=3 SV=2 755 883 3.0E-07
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 755 946 3.0E-07
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895 PE=3 SV=1 754 946 3.0E-07
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 800 946 3.0E-07
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 761 947 3.0E-07
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 755 946 3.0E-07
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 755 945 3.0E-07
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 755 1098 3.0E-07
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 754 945 3.0E-07
sp|Q9ZR79|LRK57_ARATH L-type lectin-domain containing receptor kinase V.7 OS=Arabidopsis thaliana GN=LECRK57 PE=2 SV=2 754 944 3.0E-07
sp|P06242|KIN28_YEAST Serine/threonine-protein kinase KIN28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN28 PE=1 SV=1 755 945 3.0E-07
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 754 943 3.0E-07
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 755 945 3.0E-07
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 59 247 4.0E-07
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 754 947 4.0E-07
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 754 943 4.0E-07
sp|Q38772|CDC2A_ANTMA Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2 755 945 4.0E-07
sp|Q15569|TESK1_HUMAN Dual specificity testis-specific protein kinase 1 OS=Homo sapiens GN=TESK1 PE=1 SV=2 789 955 4.0E-07
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 754 946 4.0E-07
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 754 943 4.0E-07
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 755 944 4.0E-07
sp|P24100|CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana GN=CDKA-1 PE=1 SV=1 755 945 4.0E-07
sp|P23573|CDK2_DROME Cyclin-dependent kinase 2 OS=Drosophila melanogaster GN=Cdk2 PE=1 SV=1 755 945 4.0E-07
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 754 943 4.0E-07
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 754 946 4.0E-07
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 754 946 4.0E-07
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 754 945 4.0E-07
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 764 882 4.0E-07
sp|Q8FUI4|PKN2_COREF Serine/threonine-protein kinases drp72 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0034 PE=3 SV=1 754 945 4.0E-07
sp|P47810|WEE1_MOUSE Wee1-like protein kinase OS=Mus musculus GN=Wee1 PE=1 SV=2 755 880 4.0E-07
sp|Q7ZX42|CDK9B_XENLA Cyclin-dependent kinase 9-B OS=Xenopus laevis GN=cdk9-b PE=2 SV=1 755 946 4.0E-07
sp|Q9NWZ3|IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens GN=IRAK4 PE=1 SV=1 750 947 5.0E-07
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 755 946 5.0E-07
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 754 943 5.0E-07
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 789 946 5.0E-07
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 753 943 5.0E-07
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 789 1080 5.0E-07
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 754 943 5.0E-07
sp|Q54TA1|DRKC_DICDI Probable serine/threonine-protein kinase drkC OS=Dictyostelium discoideum GN=drkC PE=3 SV=1 708 946 5.0E-07
sp|Q6DFE0|WEE2C_XENLA Wee1-like protein kinase 2-C OS=Xenopus laevis GN=wee2-c PE=2 SV=1 786 882 5.0E-07
sp|Q6C7U8|PHO85_YARLI Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 755 945 5.0E-07
sp|A2Y4B6|CDKD1_ORYSI Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. indica GN=CDKD-1 PE=2 SV=1 754 945 5.0E-07
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 755 947 6.0E-07
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 755 944 6.0E-07
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 753 946 6.0E-07
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 754 1079 6.0E-07
sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens GN=CDK5 PE=1 SV=3 755 945 6.0E-07
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 755 944 6.0E-07
sp|P29620|CDKD1_ORYSJ Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. japonica GN=CDKD-1 PE=1 SV=1 754 945 6.0E-07
sp|O57473|WEE2B_XENLA Wee1-like protein kinase 2-B OS=Xenopus laevis GN=wee2-b PE=1 SV=1 786 882 6.0E-07
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 755 946 6.0E-07
sp|Q8VZD5|KSG5_ARATH Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1 732 957 6.0E-07
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 755 883 6.0E-07
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 755 944 6.0E-07
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 755 1098 7.0E-07
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 755 946 7.0E-07
sp|Q8R4K2|IRAK4_MOUSE Interleukin-1 receptor-associated kinase 4 OS=Mus musculus GN=Irak4 PE=1 SV=1 753 947 7.0E-07
sp|Q96285|LRK55_ARATH L-type lectin-domain containing receptor kinase V.5 OS=Arabidopsis thaliana GN=LECRK55 PE=1 SV=1 754 944 7.0E-07
sp|P49615|CDK5_MOUSE Cyclin-dependent-like kinase 5 OS=Mus musculus GN=Cdk5 PE=1 SV=1 755 945 7.0E-07
sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus GN=CDK5 PE=1 SV=2 755 945 7.0E-07
sp|Q1KTF2|HOG1_ZYMTI Mitogen-activated protein kinase Hog1 OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) GN=Hog1 PE=3 SV=2 755 953 7.0E-07
sp|B1H3E1|NLK2_XENTR Serine/threonine-protein kinase NLK2 OS=Xenopus tropicalis GN=nlk.2 PE=2 SV=1 725 945 7.0E-07
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 755 946 7.0E-07
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 755 1098 7.0E-07
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 725 950 7.0E-07
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 755 946 8.0E-07
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 755 1098 8.0E-07
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 755 882 8.0E-07
sp|P49187|MK10_RAT Mitogen-activated protein kinase 10 OS=Rattus norvegicus GN=Mapk10 PE=1 SV=2 755 945 8.0E-07
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 755 942 8.0E-07
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 754 944 9.0E-07
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 755 943 9.0E-07
sp|Q55CE0|MKCF_DICDI Probable serine/threonine-protein kinase mkcF OS=Dictyostelium discoideum GN=mkcF PE=3 SV=1 753 946 9.0E-07
sp|F1N9Y5|KSYK_CHICK Tyrosine-protein kinase SYK OS=Gallus gallus GN=SYK PE=1 SV=2 738 943 9.0E-07
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 766 882 9.0E-07
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 800 943 9.0E-07
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 790 943 9.0E-07
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 59 270 1.0E-06
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 742 944 1.0E-06
sp|O44408|KGB1_CAEEL GLH-binding kinase 1 OS=Caenorhabditis elegans GN=kgb-1 PE=1 SV=2 746 945 1.0E-06
sp|Q9R0G8|NRK_MOUSE Nik-related protein kinase OS=Mus musculus GN=Nrk PE=1 SV=2 790 943 1.0E-06
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 755 945 1.0E-06
sp|Q63802|WEE1_RAT Wee1-like protein kinase OS=Rattus norvegicus GN=Wee1 PE=1 SV=1 755 880 1.0E-06
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 754 943 1.0E-06
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 755 945 1.0E-06
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 752 955 1.0E-06
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 754 943 1.0E-06
sp|Q41639|CDC2_VIGAC Cell division control protein 2 homolog OS=Vigna aconitifolia GN=CDC2 PE=2 SV=1 755 945 1.0E-06
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 749 946 1.0E-06
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 754 943 1.0E-06
sp|Q8WQG9|JNK1_CAEEL Stress-activated protein kinase jnk-1 OS=Caenorhabditis elegans GN=jnk-1 PE=1 SV=2 729 945 1.0E-06
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 769 952 1.0E-06
sp|P52389|CDC2_VIGUN Cell division control protein 2 homolog OS=Vigna unguiculata GN=CDC2 PE=2 SV=1 755 945 1.0E-06
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 741 944 1.0E-06
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 800 943 1.0E-06
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 755 944 1.0E-06
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 754 941 1.0E-06
sp|Q9M1Z9|LRK58_ARATH Putative L-type lectin-domain containing receptor kinase V.8 OS=Arabidopsis thaliana GN=LECRK58 PE=3 SV=1 754 944 1.0E-06
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 754 943 1.0E-06
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 755 946 1.0E-06
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 790 943 1.0E-06
sp|P23572|CDK1_DROME Cyclin-dependent kinase 1 OS=Drosophila melanogaster GN=Cdk1 PE=1 SV=1 755 945 1.0E-06
sp|Q925K9|TSSK6_MOUSE Testis-specific serine/threonine-protein kinase 6 OS=Mus musculus GN=Tssk6 PE=2 SV=1 765 945 2.0E-06
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 762 943 2.0E-06
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 769 952 2.0E-06
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 702 946 2.0E-06
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 755 945 2.0E-06
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 750 943 2.0E-06
sp|P24923|CDC21_MEDSA Cell division control protein 2 homolog 1 (Fragment) OS=Medicago sativa GN=CDC2A PE=2 SV=1 755 945 2.0E-06
sp|Q2PQN9|CDK5_GLOMM Cyclin-dependent kinase 5 homolog OS=Glossina morsitans morsitans GN=Cdk5 PE=2 SV=1 755 945 2.0E-06
sp|P0C5E2|Y1839_ARATH Probable serine/threonine-protein kinase At1g18390 OS=Arabidopsis thaliana GN=At1g18390 PE=2 SV=2 755 941 2.0E-06
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 754 946 2.0E-06
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 755 943 2.0E-06
sp|P31152|MK04_HUMAN Mitogen-activated protein kinase 4 OS=Homo sapiens GN=MAPK4 PE=1 SV=2 755 1080 2.0E-06
sp|Q9YHZ5|PIM2_DANRE Serine/threonine-protein kinase pim-2 OS=Danio rerio GN=pim2 PE=2 SV=2 753 902 2.0E-06
sp|Q9LEA3|LRK56_ARATH Putative L-type lectin-domain containing receptor kinase V.6 OS=Arabidopsis thaliana GN=LECRK56 PE=3 SV=3 754 944 2.0E-06
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 754 946 2.0E-06
sp|Q8QGV6|NLK2_XENLA Serine/threonine-protein kinase NLK2 OS=Xenopus laevis GN=nlk.2 PE=1 SV=1 738 945 2.0E-06
sp|Q336M2|CDKE1_ORYSJ Cyclin-dependent kinase E-1 OS=Oryza sativa subsp. japonica GN=CDKE-1 PE=2 SV=2 770 945 2.0E-06
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 701 943 2.0E-06
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 745 943 2.0E-06
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 754 946 2.0E-06
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 701 943 2.0E-06
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 755 945 2.0E-06
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 735 944 2.0E-06
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 754 946 2.0E-06
sp|P06784|STE7_YEAST Serine/threonine-protein kinase STE7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE7 PE=1 SV=1 755 947 2.0E-06
sp|Q9U6D2|JNK1_ANCCA Stress-activated protein kinase JNK-1 OS=Ancylostoma caninum GN=JNK-1 PE=2 SV=2 754 945 2.0E-06
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 746 901 2.0E-06
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 755 943 3.0E-06
sp|P97820|M4K4_MOUSE Mitogen-activated protein kinase kinase kinase kinase 4 OS=Mus musculus GN=Map4k4 PE=1 SV=1 754 943 3.0E-06
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 704 951 3.0E-06
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 754 943 3.0E-06
sp|A1CHL6|ATG1_ASPCL Serine/threonine-protein kinase atg1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg1 PE=3 SV=1 755 946 3.0E-06
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 710 943 3.0E-06
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 755 1011 3.0E-06
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 755 945 3.0E-06
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 744 944 3.0E-06
sp|Q9SYS3|CRK40_ARATH Cysteine-rich receptor-like protein kinase 40 OS=Arabidopsis thaliana GN=CRK40 PE=2 SV=1 751 943 3.0E-06
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 755 945 3.0E-06
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 753 951 3.0E-06
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 724 1087 3.0E-06
sp|P46549|SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans GN=kin-18 PE=2 SV=1 755 880 3.0E-06
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 753 943 3.0E-06
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 753 944 3.0E-06
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 744 944 3.0E-06
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 755 952 3.0E-06
sp|E1BTE1|WEE2_CHICK Wee1-like protein kinase 2 OS=Gallus gallus GN=WEE2 PE=3 SV=1 755 882 4.0E-06
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 755 896 4.0E-06
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 755 945 4.0E-06
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 753 943 4.0E-06
sp|Q00537|CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2 755 945 4.0E-06
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 739 943 4.0E-06
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 754 945 4.0E-06
sp|P17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 755 945 4.0E-06
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 755 943 4.0E-06
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 755 943 4.0E-06
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 755 943 4.0E-06
sp|O13958|SSN3_SCHPO Serine/threonine-protein kinase srb10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srb10 PE=1 SV=2 753 945 4.0E-06
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 753 943 4.0E-06
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 755 943 4.0E-06
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 755 904 4.0E-06
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 755 943 4.0E-06
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 755 943 5.0E-06
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 748 943 5.0E-06
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 755 943 5.0E-06
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 766 882 5.0E-06
sp|Q9SYS7|CRK39_ARATH Putative cysteine-rich receptor-like protein kinase 39 OS=Arabidopsis thaliana GN=CRK39 PE=3 SV=1 751 943 5.0E-06
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 755 943 5.0E-06
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 743 955 5.0E-06
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 800 943 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006397 mRNA processing Yes
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0004540 ribonuclease activity Yes
GO:0006468 protein phosphorylation Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016301 kinase activity No
GO:0019538 protein metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0043168 anion binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0140098 catalytic activity, acting on RNA No
GO:0006793 phosphorus metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006396 RNA processing No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0016071 mRNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0009987 cellular process No
GO:0032553 ribonucleotide binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0004518 nuclease activity No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0003674 molecular_function No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|116250
MLFFPLLVVATVALARILSIHPPHPAHSALAERPNPYQYSHAARDQPDAHLDDLELLDIVLLASVDGKLHALNRT
SGETLWSMTPASNSSSSSPAALSPLVRTDHIDYDPEVTDDNSQAAYIIEPQSGDIYIMPNPSSPLQRFPFSMQEL
VDMSPFSFRGEDDSRVFVGKKETSLLVVELQTGKIKATLNSECPWDQFDNIKDELDLDELEDSVPPKTPPAEVYI
GRTDYHVSIISTRSGKLDGSVTRPPIQNLSFSTYGPNRQDSHIQSLYRRTKDNTYIQSLPSGELLSFKAKSSVDS
IATTYNDHLLWARNAFSQPIVAVFDVVNRKPSSKLDISTHPFVLLQPRPRIHDLIPGLSPMTKESPLSAYIGLVE
ETGSLFALTPNRFPLVAFGRPQNQPQQRKGHPLLDGKDGLSGEDEDEDEEVTSVDEITRRRKLHEAKSSLSSSHR
LEENLQCHATILNDRRCLVGIHRLELDQGDGHETRMKRLLDASPEQNDYIDPSSYSQQQSPSNESKNRPLSIDPP
TEASDDVSPSPVFAGSGVLGIGKAVWTTLILGFLVTFGILRWKSGSSWIVQKDVVEQQPTVINITQNDVSAVVAK
EIKEIREEPISSEQNQASSPLVLPPVTASTVKPLPPTPQLPTGAGDETDKEDLDGGVQTEGENDDLPAAPAVGRG
NDPTTPKKKTRRGKRGAKKAKNGTGDPVPNDMKMNGKDVAVDLGEEGTKLPKMPSSLILTSTPKAVSAPKPSLVV
SDNILGYGSHGTVVYKGSLQGRAVAVKRLLADFVTLASREVSILQESDDHPNVIRYYYQEAHAGFLYIALELCPA
SLADLIEMPDRDAWRDIAVSFDPKRALKQVTNGLRHLHALKLVHRDIKPQNILVSTKGGGLSGAGSGGGAAARGT
NYRMLISDFGLCKKLDVDQTSFMPTVHGAMAAGTVGWRAPEILRGEVKLDDEMGDDQSSRGSNATIHGGNHNSST
HSTSSSNSSSSSSSNPGKGRRTKLTKSVDIFALGCLYYYTLTGGGHPFGDRYEREVNIMKNEKNLEMLERFGEEG
TEAADLIEKMLDPIPSERPDTTSCLLHPFFWDCSRRLNFLQEASDRFEFMCRDPKDPDLLALEENVQGIIGNDWH
SRMDRVFIENLGKYRKYDGRSVQDLLRALRNKKHHYQDLPDNVKRHLGPMPEGFLAYFTRRFPRLFLHVHRVVRE
TGLANESVFRSYFELPDS*
Coding >AgabiH97|116250
ATGCTCTTCTTCCCTCTCCTCGTCGTAGCCACCGTCGCCCTCGCCCGCATCCTCTCTATCCATCCCCCTCATCCC
GCCCACTCTGCCCTCGCAGAACGCCCCAATCCATACCAATACTCACACGCCGCCCGCGACCAGCCAGATGCCCAT
CTCGATGACTTGGAGCTCCTCGACATCGTCCTCTTGGCCTCGGTGGACGGCAAACTCCATGCGCTCAACCGCACC
TCTGGCGAAACCCTCTGGTCCATGACCCCCGCTTCCAACTCCTCATCTTCCAGCCCCGCAGCATTATCTCCCCTA
GTCCGCACAGACCATATAGACTATGATCCAGAGGTCACCGATGACAACAGCCAAGCTGCCTACATCATAGAGCCG
CAGTCGGGCGACATCTATATCATGCCGAATCCGTCCTCGCCCCTTCAACGCTTCCCTTTTTCCATGCAGGAACTT
GTCGATATGTCCCCTTTTAGTTTCAGAGGCGAGGACGACAGCAGGGTCTTTGTAGGCAAAAAGGAAACATCTTTG
CTCGTCGTCGAACTCCAAACCGGTAAAATCAAGGCAACTCTCAATTCCGAATGCCCTTGGGACCAGTTTGATAAT
ATCAAGGACGAGTTGGATTTGGATGAGTTGGAGGACAGCGTACCGCCGAAAACCCCTCCCGCTGAAGTCTATATT
GGTCGTACCGACTACCATGTATCGATCATATCCACACGTTCAGGAAAGCTTGATGGATCCGTTACCCGGCCCCCC
ATTCAAAATCTTTCTTTTTCTACATATGGCCCTAACAGACAGGACAGCCACATTCAGTCCCTTTACCGCCGCACC
AAAGACAACACCTATATCCAATCGTTGCCTAGTGGCGAACTCCTTTCTTTCAAAGCCAAATCCTCCGTCGACTCC
ATCGCTACTACTTACAACGACCATTTATTATGGGCACGCAATGCTTTCAGTCAACCCATTGTCGCTGTTTTTGAT
GTCGTGAACCGCAAACCATCATCCAAATTAGACATCTCAACTCATCCTTTCGTTCTGCTTCAACCTCGACCTCGG
ATACATGATCTTATACCTGGTCTTTCCCCCATGACAAAGGAATCCCCACTTTCAGCTTACATTGGACTAGTGGAA
GAAACTGGCAGTTTGTTCGCTCTTACACCAAATCGTTTCCCGTTGGTCGCCTTTGGTCGCCCACAAAATCAACCA
CAACAACGAAAAGGTCATCCACTACTCGACGGCAAAGACGGTCTTTCTGGAGAAGATGAAGATGAAGATGAAGAA
GTCACGAGTGTAGACGAAATAACTCGACGCAGGAAGCTACATGAAGCCAAATCTTCTCTGTCGTCATCTCATCGG
CTGGAAGAGAACCTCCAATGTCATGCGACGATTCTAAACGATCGAAGATGCCTAGTTGGTATCCACAGACTCGAA
TTAGATCAAGGTGATGGTCACGAAACGAGGATGAAACGTTTATTGGATGCATCACCCGAACAGAACGATTATATC
GATCCATCATCCTATTCTCAACAACAATCTCCTTCCAATGAAAGTAAAAACCGCCCTTTGAGTATCGATCCTCCA
ACTGAAGCATCTGATGATGTTTCGCCATCACCGGTATTTGCTGGGAGCGGTGTTCTTGGTATTGGGAAAGCAGTA
TGGACGACTTTGATTTTGGGATTTTTAGTGACGTTTGGGATTTTGAGATGGAAAAGTGGTTCTTCTTGGATCGTG
CAGAAGGACGTGGTGGAACAACAACCAACGGTTATAAATATAACCCAAAATGACGTGTCAGCGGTAGTGGCGAAA
GAGATAAAGGAAATTCGAGAGGAGCCGATATCTTCCGAACAAAATCAAGCTTCCTCGCCTTTGGTATTGCCTCCT
GTAACAGCATCGACCGTCAAACCGCTGCCACCTACTCCCCAACTGCCTACTGGGGCCGGAGACGAAACAGATAAA
GAAGATCTGGACGGAGGGGTTCAAACAGAAGGAGAGAATGATGATCTCCCTGCTGCTCCTGCTGTCGGGCGTGGC
AATGATCCAACGACACCCAAAAAGAAAACGCGAAGAGGCAAACGAGGTGCTAAGAAAGCTAAAAATGGGACTGGA
GACCCCGTACCGAATGATATGAAGATGAATGGGAAAGACGTTGCGGTAGATCTTGGTGAAGAAGGAACGAAATTA
CCGAAAATGCCGAGTTCGTTGATTTTGACAAGTACTCCGAAAGCTGTAAGCGCTCCAAAACCTTCATTGGTCGTT
TCCGATAACATCCTCGGTTACGGCTCTCATGGGACTGTGGTCTACAAGGGTTCACTCCAAGGTCGAGCAGTGGCA
GTCAAGCGTCTTTTGGCCGATTTCGTCACGCTCGCTTCTCGTGAAGTATCGATTTTACAAGAATCCGATGATCAT
CCAAACGTCATTCGATACTACTATCAAGAAGCTCATGCTGGATTCCTATATATCGCTTTGGAGCTATGTCCGGCG
AGTTTGGCGGATTTGATTGAGATGCCGGATAGAGATGCCTGGAGGGATATTGCTGTTAGCTTTGACCCGAAGAGA
GCGCTGAAGCAGGTTACAAATGGCTTGAGACATTTGCATGCTTTGAAATTGGTTCATAGGGACATTAAGCCCCAG
AATATTTTGGTTTCGACTAAGGGTGGTGGGCTCAGTGGTGCGGGGAGTGGGGGAGGCGCGGCAGCGAGGGGAACG
AATTATCGGATGTTGATTTCGGATTTTGGGCTGTGTAAGAAATTGGATGTGGACCAGACGAGTTTTATGCCCACT
GTTCATGGGGCTATGGCTGCTGGTACTGTTGGTTGGCGTGCACCGGAAATATTACGGGGTGAAGTCAAGTTGGAT
GATGAAATGGGAGACGACCAGTCATCTCGGGGTTCCAATGCTACCATCCACGGCGGAAATCATAACTCTTCCACC
CATTCAACGTCTTCGAGTAACTCTTCGTCCTCATCCTCGTCGAACCCTGGCAAGGGGAGACGAACGAAATTGACG
AAGAGTGTGGATATTTTTGCGTTGGGATGTTTGTATTACTATACCTTGACTGGAGGCGGTCATCCGTTTGGAGAT
AGGTATGAGAGGGAAGTGAATATAATGAAGAATGAGAAGAATTTGGAGATGTTGGAGAGGTTTGGAGAGGAAGGT
ACTGAAGCTGCGGATTTGATTGAAAAAATGTTGGATCCTATACCCTCTGAACGCCCGGATACAACGTCGTGTCTG
TTACATCCATTTTTCTGGGACTGTTCAAGACGATTAAATTTCTTGCAAGAAGCATCGGATCGATTTGAATTCATG
TGTAGGGATCCGAAAGATCCTGATCTATTAGCTTTGGAGGAGAATGTGCAGGGTATAATTGGGAATGATTGGCAT
TCGAGGATGGATAGAGTGTTTATTGAGAATTTGGGGAAATATAGGAAGTATGATGGGAGGAGTGTACAAGATTTG
TTGAGAGCTTTGAGGAATAAGAAACATCATTATCAAGATTTACCAGATAATGTCAAACGGCATTTAGGACCTATG
CCGGAAGGGTTCCTGGCGTATTTCACGAGAAGGTTTCCGAGATTGTTTTTGCATGTACATCGAGTGGTGAGAGAA
ACGGGACTTGCCAATGAATCGGTTTTTAGAAGTTATTTCGAGTTGCCGGATTCATGA
Transcript >AgabiH97|116250
ATGCTCTTCTTCCCTCTCCTCGTCGTAGCCACCGTCGCCCTCGCCCGCATCCTCTCTATCCATCCCCCTCATCCC
GCCCACTCTGCCCTCGCAGAACGCCCCAATCCATACCAATACTCACACGCCGCCCGCGACCAGCCAGATGCCCAT
CTCGATGACTTGGAGCTCCTCGACATCGTCCTCTTGGCCTCGGTGGACGGCAAACTCCATGCGCTCAACCGCACC
TCTGGCGAAACCCTCTGGTCCATGACCCCCGCTTCCAACTCCTCATCTTCCAGCCCCGCAGCATTATCTCCCCTA
GTCCGCACAGACCATATAGACTATGATCCAGAGGTCACCGATGACAACAGCCAAGCTGCCTACATCATAGAGCCG
CAGTCGGGCGACATCTATATCATGCCGAATCCGTCCTCGCCCCTTCAACGCTTCCCTTTTTCCATGCAGGAACTT
GTCGATATGTCCCCTTTTAGTTTCAGAGGCGAGGACGACAGCAGGGTCTTTGTAGGCAAAAAGGAAACATCTTTG
CTCGTCGTCGAACTCCAAACCGGTAAAATCAAGGCAACTCTCAATTCCGAATGCCCTTGGGACCAGTTTGATAAT
ATCAAGGACGAGTTGGATTTGGATGAGTTGGAGGACAGCGTACCGCCGAAAACCCCTCCCGCTGAAGTCTATATT
GGTCGTACCGACTACCATGTATCGATCATATCCACACGTTCAGGAAAGCTTGATGGATCCGTTACCCGGCCCCCC
ATTCAAAATCTTTCTTTTTCTACATATGGCCCTAACAGACAGGACAGCCACATTCAGTCCCTTTACCGCCGCACC
AAAGACAACACCTATATCCAATCGTTGCCTAGTGGCGAACTCCTTTCTTTCAAAGCCAAATCCTCCGTCGACTCC
ATCGCTACTACTTACAACGACCATTTATTATGGGCACGCAATGCTTTCAGTCAACCCATTGTCGCTGTTTTTGAT
GTCGTGAACCGCAAACCATCATCCAAATTAGACATCTCAACTCATCCTTTCGTTCTGCTTCAACCTCGACCTCGG
ATACATGATCTTATACCTGGTCTTTCCCCCATGACAAAGGAATCCCCACTTTCAGCTTACATTGGACTAGTGGAA
GAAACTGGCAGTTTGTTCGCTCTTACACCAAATCGTTTCCCGTTGGTCGCCTTTGGTCGCCCACAAAATCAACCA
CAACAACGAAAAGGTCATCCACTACTCGACGGCAAAGACGGTCTTTCTGGAGAAGATGAAGATGAAGATGAAGAA
GTCACGAGTGTAGACGAAATAACTCGACGCAGGAAGCTACATGAAGCCAAATCTTCTCTGTCGTCATCTCATCGG
CTGGAAGAGAACCTCCAATGTCATGCGACGATTCTAAACGATCGAAGATGCCTAGTTGGTATCCACAGACTCGAA
TTAGATCAAGGTGATGGTCACGAAACGAGGATGAAACGTTTATTGGATGCATCACCCGAACAGAACGATTATATC
GATCCATCATCCTATTCTCAACAACAATCTCCTTCCAATGAAAGTAAAAACCGCCCTTTGAGTATCGATCCTCCA
ACTGAAGCATCTGATGATGTTTCGCCATCACCGGTATTTGCTGGGAGCGGTGTTCTTGGTATTGGGAAAGCAGTA
TGGACGACTTTGATTTTGGGATTTTTAGTGACGTTTGGGATTTTGAGATGGAAAAGTGGTTCTTCTTGGATCGTG
CAGAAGGACGTGGTGGAACAACAACCAACGGTTATAAATATAACCCAAAATGACGTGTCAGCGGTAGTGGCGAAA
GAGATAAAGGAAATTCGAGAGGAGCCGATATCTTCCGAACAAAATCAAGCTTCCTCGCCTTTGGTATTGCCTCCT
GTAACAGCATCGACCGTCAAACCGCTGCCACCTACTCCCCAACTGCCTACTGGGGCCGGAGACGAAACAGATAAA
GAAGATCTGGACGGAGGGGTTCAAACAGAAGGAGAGAATGATGATCTCCCTGCTGCTCCTGCTGTCGGGCGTGGC
AATGATCCAACGACACCCAAAAAGAAAACGCGAAGAGGCAAACGAGGTGCTAAGAAAGCTAAAAATGGGACTGGA
GACCCCGTACCGAATGATATGAAGATGAATGGGAAAGACGTTGCGGTAGATCTTGGTGAAGAAGGAACGAAATTA
CCGAAAATGCCGAGTTCGTTGATTTTGACAAGTACTCCGAAAGCTGTAAGCGCTCCAAAACCTTCATTGGTCGTT
TCCGATAACATCCTCGGTTACGGCTCTCATGGGACTGTGGTCTACAAGGGTTCACTCCAAGGTCGAGCAGTGGCA
GTCAAGCGTCTTTTGGCCGATTTCGTCACGCTCGCTTCTCGTGAAGTATCGATTTTACAAGAATCCGATGATCAT
CCAAACGTCATTCGATACTACTATCAAGAAGCTCATGCTGGATTCCTATATATCGCTTTGGAGCTATGTCCGGCG
AGTTTGGCGGATTTGATTGAGATGCCGGATAGAGATGCCTGGAGGGATATTGCTGTTAGCTTTGACCCGAAGAGA
GCGCTGAAGCAGGTTACAAATGGCTTGAGACATTTGCATGCTTTGAAATTGGTTCATAGGGACATTAAGCCCCAG
AATATTTTGGTTTCGACTAAGGGTGGTGGGCTCAGTGGTGCGGGGAGTGGGGGAGGCGCGGCAGCGAGGGGAACG
AATTATCGGATGTTGATTTCGGATTTTGGGCTGTGTAAGAAATTGGATGTGGACCAGACGAGTTTTATGCCCACT
GTTCATGGGGCTATGGCTGCTGGTACTGTTGGTTGGCGTGCACCGGAAATATTACGGGGTGAAGTCAAGTTGGAT
GATGAAATGGGAGACGACCAGTCATCTCGGGGTTCCAATGCTACCATCCACGGCGGAAATCATAACTCTTCCACC
CATTCAACGTCTTCGAGTAACTCTTCGTCCTCATCCTCGTCGAACCCTGGCAAGGGGAGACGAACGAAATTGACG
AAGAGTGTGGATATTTTTGCGTTGGGATGTTTGTATTACTATACCTTGACTGGAGGCGGTCATCCGTTTGGAGAT
AGGTATGAGAGGGAAGTGAATATAATGAAGAATGAGAAGAATTTGGAGATGTTGGAGAGGTTTGGAGAGGAAGGT
ACTGAAGCTGCGGATTTGATTGAAAAAATGTTGGATCCTATACCCTCTGAACGCCCGGATACAACGTCGTGTCTG
TTACATCCATTTTTCTGGGACTGTTCAAGACGATTAAATTTCTTGCAAGAAGCATCGGATCGATTTGAATTCATG
TGTAGGGATCCGAAAGATCCTGATCTATTAGCTTTGGAGGAGAATGTGCAGGGTATAATTGGGAATGATTGGCAT
TCGAGGATGGATAGAGTGTTTATTGAGAATTTGGGGAAATATAGGAAGTATGATGGGAGGAGTGTACAAGATTTG
TTGAGAGCTTTGAGGAATAAGAAACATCATTATCAAGATTTACCAGATAATGTCAAACGGCATTTAGGACCTATG
CCGGAAGGGTTCCTGGCGTATTTCACGAGAAGGTTTCCGAGATTGTTTTTGCATGTACATCGAGTGGTGAGAGAA
ACGGGACTTGCCAATGAATCGGTTTTTAGAAGTTATTTCGAGTTGCCGGATTCATGA
Gene >AgabiH97|116250
ATGCTCTTCTTCCCTCTCCTCGTCGTAGCCACCGTCGCCCTCGCCCGCATCCTCTCTATCCATCCCCCTCATCCC
GCCCACTCTGCCCTCGCAGAACGCCCCAATCCATACCAATACTCACACGCCGCCCGCGACCAGCCAGATGCCCAT
CTCGATGACTTGGAGCTCCTCGACATCGTCCTCTTGGCCTCGGTGGACGGCAAACTCCATGCGCTCAACCGCACC
TCTGGCGAAACCCTCTGGTCCATGACCCCCGCTTCCAACTCCTCATCTTCCAGCCCCGCAGCATTATCTCCCCTA
GTCCGCACAGACCATATAGACTATGATCCAGAGGTCACCGATGACAACAGCCAAGCTGCCTACATCATAGAGCCG
CAGTCGGGCGACATCTATATCATGCCGAATCCGTCCTCGCCCCTTCAACGCTTCCCTTTTTCCATGCAGGAACTT
GTCGATATGTCCCCTTTTAGTTTCAGAGGCGAGGACGACAGCAGGGTCTTTGTAGGCAAAAAGGAAACATCTTTG
CTCGTCGTCGAACTCCAAACCGGTAAAATCAAGGCAACTCTCAATTCCGAATGCCCTTGGGACCAGTTTGATAAT
ATCAAGGACGAGTTGGATTTGGATGAGTTGGAGGACAGCGTACCGCCGAAAACCCCTCCCGCTGAAGTCTATATT
GGTCGTACCGGTATGATCTCCCCGCTCTTTTTTCAACGCGCGGCTAAAAGCGCGGCACAGACTACCATGTATCGA
TCATATCCACACGTTCAGGAAAGCTTGATGGATCCGTTACCCGGCCCCCCATTCAAAATCTTTCTTTTTCTACAT
ATGGCCCTAACAGACAGGACAGCCACATTCAGTCCCTTTACCGCCGCACCAAAGACAACACCTATATCCAATCGT
TGCCTAGTGGCGAACTCCTTTCTTTCAAAGCCAAATCCTCCGTCGACTCCATCGCTACTACTTACAACGACCATT
TATTATGGGCACGCAATGCTTTCAGTCAACCCATGTAAGTTGACATCAATCTATAAATTTGCATGTATTAAGATC
TGTTCAGTGTCGCTGTTTTTGATGTCGTGAACCGCAAACCATCATCCAAATTAGACATCTCAACTCATCCTTTCG
TTCTGCTTCAACCTCGACCTCGGATACATGATCTTATACCTGGTCTTTCCCCCATGACAAAGGAATCCCCACTTT
CAGCTTACATTGGACTAGTGGAAGAAACTGGCAGTTTGTTCGCTCTTACACCAAATCGTTTCCCGTTGGTCGCCT
TTGGTCGCCCACAAAATCAACCACAACAACGAAAAGGTCATCCACTACTCGACGGCAAAGACGGTCTTTCTGGAG
AAGATGAAGATGAAGATGAAGAAGTCACGAGTGTAGACGAAATAACTCGACGCAGGAAGCTACATGAAGCCAAAT
CTTCTCTGTCGTCATCTCATCGGCTGGAAGAGAACCTCCAATGTCATGCGACGATTCTAAACGATCGAAGATGCC
TAGTTGGTATCCACAGACTCGAATTAGATCAAGGTGATGGTCACGAAACGAGGATGAAACGTTTATTGGATGCAT
CACCCGAACAGAACGATTATATCGATCCATCATCCTATTCTCAACAACAATCTCCTTCCAATGAAAGTAAAAACC
GCCCTTTGAGTATCGATCCTCCAACTGAAGCATCTGATGATGTTTCGCCATCACCGGTATTTGCTGGGAGCGGTG
TTCTTGGTATTGGGAAAGCAGTATGGACGACTTTGATTTTGGGATTTTTAGTGACGTTTGGGATTTTGAGATGGA
AAAGTGGTTCTTCTTGGATCGTGCAGAAGGACGTGGTGGAACAACAACCAACGGTTATAAATATAACCCAAAATG
ACGTGTCAGCGGTAGTGGCGAAAGAGATAAAGGAAATTCGAGAGGAGCCGATATCTTCCGAACAAAATCAAGCTT
CCTCGCCTTTGGTATTGCCTCCTGTAACAGCATCGACCGTCAAACCGCTGCCACCTACTCCCCAACTGCCTACTG
GGGCCGGAGACGAAACAGATAAAGAAGATCTGGACGGAGGGGTTCAAACAGAAGGAGAGAATGATGATCTCCCTG
CTGCTCCTGCTGTCGGGCGTGGCAATGATCCAACGACACCCAAAAAGAAAACGCGAAGAGGCAAACGAGGTGCTA
AGAAAGCTAAAAATGGGACTGGAGACCCCGTACCGAATGATATGAAGATGAATGGGAAAGACGTTGCGGTAGATC
TTGGTGAAGAAGGAACGAAATTACCGAAAATGCCGAGTTCGTTGATTTTGACAAGTACTCCGAAAGCTGTAAGCG
CTCCAAAACCTTCATTGGTCGTTTCCGATAACATCCTCGGTATGTTACTTCCTCGTACCTTTCTTGTCTCTTTTA
CTAAAAGCGTTTAAGGTTACGGCTCTCATGGGACTGTGGTCTACAAGGGTTCACTCCAAGGTCGAGCAGTGGCAG
TCAAGCGTCTTTTGGCCGATTTCGTCACGCTCGCTTCTCGTGAAGTATCGATTTTACAAGAATCCGATGATCATC
CAAACGTCATTCGATACTACTATCAAGAAGCTCATGCTGGATTCCTATATATCGCTTTGGAGCTATGTCCGGCGA
GTTTGGCGGATTTGATTGAGATGCCGGATAGAGATGCCTGGAGGGATATTGCTGTTAGCTTTGACCCGAAGAGAG
CGCTGAAGCAGGTTACAAATGGCTTGAGACATTTGCATGCTTTGAAATTGGTTCATAGGGACATTAAGCCCCAGA
ATATTTTGGTTTCGACTAAGGGTGGTGGGCTCAGTGGTGCGGGGAGTGGGGGAGGCGCGGCAGCGAGGGGAACGA
ATTATCGGATGTTGATTTCGGATTTTGGGCTGTGTAAGAAATTGGATGTGGACCAGACGAGTTTTATGCCCACTG
TTCATGGGGCTATGGCTGCTGGTACTGTTGGTTGGCGTGCACCGGAAATATTACGGGGTGAAGTCAAGTTGGATG
ATGAAATGGGAGACGACCAGTCATCTCGGGGTTCCAATGCTACCATCCACGGCGGAAATCATAACTCTTCCACCC
ATTCAACGTCTTCGAGTAACTCTTCGTCCTCATCCTCGTCGAACCCTGGCAAGGGGAGACGAACGAAATTGACGA
AGAGTGTGGATATTTTTGCGTTGGGATGTTTGTATTACTATACCTTGACTGGAGGCGGTCATCCGTTTGGAGATA
GGTATGAGAGGGAAGTGAATATAATGAAGAATGAGAAGAATTTGGAGATGTTGGAGAGGTTTGGAGAGGAAGGTA
CTGAAGCTGCGGATTTGATTGAAAAAATGTTGGATCCTATACCCTCTGAACGGTACGTCATTTGCATTCATTCGT
CCTTTGAACCTTTCAATCTCAAATTGTTTGATTTTTTGATAGCCCGGATACAACGTCGTGTCTGTTACATCCATT
TTTCTGGGACTGTTCAAGACGATTAAATTTCTTGCAAGAAGCATCGGATCGATTTGAATTCATGTGTAGGGATCC
GAAAGATCCTGATCTATTAGCTTTGGAGGAGAATGTGCAGGGTATAATTGGGAATGATTGGCATTCGAGGATGGA
TAGAGTGTTTATTGAGAATTTGGGGAAATATAGGAAGTATGATGGGAGGAGTGTACAAGATTTGTTGAGAGCTTT
GAGGAATAAGGTTCGTTCTCTCTTCCTTTTACTGCTCTACATTACAATTCGTTGACGGTACTACGTGCGGCGCTT
TTACAGAAACATCATTATCAAGATTTACCAGATAATGTCAAACGGCATTTAGGACCTATGCCGGAAGGGTTCCTG
GCGTATTTCACGAGAAGGTTTCCGAGATTGTTTTTGCATGTACATCGAGTGGTGAGAGAAACGGGACTTGCCAAT
GAATCGGTTTTTAGAAGTTATTTCGAGTTGCCGGATTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail