Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|116240
Gene name
Locationscaffold_9:674656..675025
Strand+
Gene length (bp)369
Transcript length (bp)201
Coding sequence length (bp)201
Protein length (aa) 67

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 508.06 229.72 786.40
Initials Initials knots 58.55 14.16 102.94
Pileal_Stipeal_center Stage I stipe center 9.02 0.00 21.00
Pileal_Stipeal_shell Stage I stipe shell 4.72 0.00 13.28
DIF_stipe_center Stage II stipe center 7.85 0.00 18.05
DIF_stipe_shell Stage II stipe shell 7.87 0.00 18.62
DIF_stipe_skin Stage II stipe skin 8.24 0.00 19.73
DIF_cap_skin Stage II cap skin 8.46 0.00 20.60
DIF_cap_tissue Stage II cap tissue 9.09 0.00 21.28
DIF_gill_tissue Stage II gill tissue 7.29 0.00 17.91
YFB_stipe_center Young fruiting body stipe center 15.18 0.00 31.69
YFB_stipe_shell Young fruiting body stipe shell 11.83 0.00 26.02
YFB_stipe_skin Young fruiting body stipe skin 13.48 0.00 28.95
YFB_cap_skin Young fruiting body cap skin 12.02 0.00 26.73
YFB_cap_tissue Young fruiting body cap tissue 12.77 0.00 27.88
YFB_gill_tissue Young fruiting body gill tissue 6.81 0.00 17.09
YFB_veil Young fruiting body veil 4.32 0.00 12.78

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.020790 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.005302 yes
Casing YFB_stipe_skin 0.001625 yes
Casing YFB_cap_skin 0.002951 yes
Casing YFB_cap_tissue 0.002084 yes
Casing YFB_gill_tissue 0.041164 yes
Casing YFB_veil 0.158500 no
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.007092 yes
Casing Pileal_Stipeal_shell 0.094821 no
Casing DIF_stipe_center 0.010093 yes
Casing DIF_stipe_shell 0.024698 yes
Casing DIF_stipe_skin 0.008457 yes
Casing DIF_cap_skin 0.011968 yes
Casing DIF_cap_tissue 0.005671 yes
DIF_gill_tissue YFB_stipe_center 0.508897 no
DIF_gill_tissue YFB_stipe_shell 0.729978 no
DIF_gill_tissue YFB_stipe_skin 0.608712 no
DIF_gill_tissue YFB_cap_skin 0.721630 no
DIF_gill_tissue YFB_cap_tissue 0.665296 no
DIF_gill_tissue YFB_gill_tissue 0.967573 no
DIF_gill_tissue YFB_veil 0.769973 no
YFB_stipe_center YFB_stipe_shell 0.862568 no
YFB_stipe_center YFB_stipe_skin 0.934722 no
YFB_stipe_center YFB_cap_skin 0.870089 no
YFB_stipe_center YFB_cap_tissue 0.907101 no
YFB_stipe_center YFB_gill_tissue 0.509225 no
YFB_stipe_center YFB_veil 0.354472 no
YFB_stipe_shell YFB_stipe_skin 0.935328 no
YFB_stipe_shell YFB_cap_skin 0.977466 no
YFB_stipe_shell YFB_cap_tissue 0.966718 no
YFB_stipe_shell YFB_gill_tissue 0.708942 no
YFB_stipe_shell YFB_veil 0.499974 no
YFB_stipe_skin YFB_cap_skin 0.943318 no
YFB_stipe_skin YFB_cap_tissue 0.975107 no
YFB_stipe_skin YFB_gill_tissue 0.615838 no
YFB_stipe_skin YFB_veil 0.399284 no
YFB_cap_skin YFB_cap_tissue 0.975242 no
YFB_cap_skin YFB_gill_tissue 0.686936 no
YFB_cap_skin YFB_veil 0.489780 no
YFB_cap_tissue YFB_gill_tissue 0.647770 no
YFB_cap_tissue YFB_veil 0.480337 no
YFB_gill_tissue YFB_veil 0.826161 no
Initials DIF_gill_tissue 0.043772 yes
Initials YFB_stipe_center 0.050499 no
Initials YFB_stipe_shell 0.064141 no
Initials YFB_stipe_skin 0.047163 yes
Initials YFB_cap_skin 0.060104 no
Initials YFB_cap_tissue 0.065833 no
Initials YFB_gill_tissue 0.072685 no
Initials YFB_veil 0.159049 no
Initials Pileal_Stipeal_center 0.044631 yes
Initials Pileal_Stipeal_shell 0.102350 no
Initials DIF_stipe_center 0.045911 yes
Initials DIF_stipe_shell 0.067706 no
Initials DIF_stipe_skin 0.043121 yes
Initials DIF_cap_skin 0.054375 no
Initials DIF_cap_tissue 0.046745 yes
Pileal_Stipeal_center DIF_gill_tissue 0.906765 no
Pileal_Stipeal_center YFB_stipe_center 0.660549 no
Pileal_Stipeal_center YFB_stipe_shell 0.861912 no
Pileal_Stipeal_center YFB_stipe_skin 0.772059 no
Pileal_Stipeal_center YFB_cap_skin 0.841337 no
Pileal_Stipeal_center YFB_cap_tissue 0.810956 no
Pileal_Stipeal_center YFB_gill_tissue 0.881815 no
Pileal_Stipeal_center YFB_veil 0.630458 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.692242 no
Pileal_Stipeal_center DIF_stipe_center 0.939527 no
Pileal_Stipeal_center DIF_stipe_shell 0.942519 no
Pileal_Stipeal_center DIF_stipe_skin 0.966429 no
Pileal_Stipeal_center DIF_cap_skin 0.974793 no
Pileal_Stipeal_center DIF_cap_tissue 0.973927 no
Pileal_Stipeal_shell DIF_gill_tissue 0.805181 no
Pileal_Stipeal_shell YFB_stipe_center 0.341679 no
Pileal_Stipeal_shell YFB_stipe_shell 0.491686 no
Pileal_Stipeal_shell YFB_stipe_skin 0.414636 no
Pileal_Stipeal_shell YFB_cap_skin 0.489311 no
Pileal_Stipeal_shell YFB_cap_tissue 0.453914 no
Pileal_Stipeal_shell YFB_gill_tissue 0.856524 no
Pileal_Stipeal_shell YFB_veil 0.960307 no
Pileal_Stipeal_shell DIF_stipe_center 0.776268 no
Pileal_Stipeal_shell DIF_stipe_shell 0.765703 no
Pileal_Stipeal_shell DIF_stipe_skin 0.742323 no
Pileal_Stipeal_shell DIF_cap_skin 0.726547 no
Pileal_Stipeal_shell DIF_cap_tissue 0.687885 no
DIF_stipe_center DIF_gill_tissue 0.968759 no
DIF_stipe_center YFB_stipe_center 0.568271 no
DIF_stipe_center YFB_stipe_shell 0.761216 no
DIF_stipe_center YFB_stipe_skin 0.654695 no
DIF_stipe_center YFB_cap_skin 0.760695 no
DIF_stipe_center YFB_cap_tissue 0.716007 no
DIF_stipe_center YFB_gill_tissue 0.944241 no
DIF_stipe_center YFB_veil 0.736440 no
DIF_stipe_center DIF_stipe_shell 0.971198 no
DIF_stipe_center DIF_stipe_skin 0.971350 no
DIF_stipe_center DIF_cap_skin 0.971185 no
DIF_stipe_center DIF_cap_tissue 0.937093 no
DIF_stipe_shell DIF_gill_tissue 0.968565 no
DIF_stipe_shell YFB_stipe_center 0.590871 no
DIF_stipe_shell YFB_stipe_shell 0.774103 no
DIF_stipe_shell YFB_stipe_skin 0.681292 no
DIF_stipe_shell YFB_cap_skin 0.773657 no
DIF_stipe_shell YFB_cap_tissue 0.739626 no
DIF_stipe_shell YFB_gill_tissue 0.946800 no
DIF_stipe_shell YFB_veil 0.750632 no
DIF_stipe_shell DIF_stipe_skin 0.971382 no
DIF_stipe_shell DIF_cap_skin 0.972375 no
DIF_stipe_shell DIF_cap_tissue 0.940297 no
DIF_stipe_skin DIF_gill_tissue 0.950627 no
DIF_stipe_skin YFB_stipe_center 0.595376 no
DIF_stipe_skin YFB_stipe_shell 0.802963 no
DIF_stipe_skin YFB_stipe_skin 0.693959 no
DIF_stipe_skin YFB_cap_skin 0.793229 no
DIF_stipe_skin YFB_cap_tissue 0.753004 no
DIF_stipe_skin YFB_gill_tissue 0.915815 no
DIF_stipe_skin YFB_veil 0.722261 no
DIF_stipe_skin DIF_cap_skin 0.972633 no
DIF_stipe_skin DIF_cap_tissue 0.961292 no
DIF_cap_skin DIF_gill_tissue 0.940333 no
DIF_cap_skin YFB_stipe_center 0.628194 no
DIF_cap_skin YFB_stipe_shell 0.830994 no
DIF_cap_skin YFB_stipe_skin 0.722590 no
DIF_cap_skin YFB_cap_skin 0.818295 no
DIF_cap_skin YFB_cap_tissue 0.762045 no
DIF_cap_skin YFB_gill_tissue 0.914788 no
DIF_cap_skin YFB_veil 0.725954 no
DIF_cap_skin DIF_cap_tissue 0.971815 no
DIF_cap_tissue DIF_gill_tissue 0.904535 no
DIF_cap_tissue YFB_stipe_center 0.654742 no
DIF_cap_tissue YFB_stipe_shell 0.860488 no
DIF_cap_tissue YFB_stipe_skin 0.770030 no
DIF_cap_tissue YFB_cap_skin 0.858347 no
DIF_cap_tissue YFB_cap_tissue 0.807638 no
DIF_cap_tissue YFB_gill_tissue 0.856681 no
DIF_cap_tissue YFB_veil 0.626833 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|116240
MQPTQLFFALVALCATAVMAGPAPAGAVEARGFICDFLPQPAADDACSTVCKQEGNGMGGHCVDAL*
Coding >AgabiH97|116240
ATGCAACCTACCCAACTCTTCTTCGCTCTCGTCGCTCTCTGCGCCACAGCCGTCATGGCTGGACCTGCCCCCGCT
GGTGCAGTTGAAGCTCGTGGCTTCATCTGTGACTTCCTTCCTCAACCTGCTGCCGATGACGCGTGCAGCACCGTC
TGCAAGCAGGAAGGCAATGGCATGGGTGGCCACTGTGTCGACGCATTGTAA
Transcript >AgabiH97|116240
ATGCAACCTACCCAACTCTTCTTCGCTCTCGTCGCTCTCTGCGCCACAGCCGTCATGGCTGGACCTGCCCCCGCT
GGTGCAGTTGAAGCTCGTGGCTTCATCTGTGACTTCCTTCCTCAACCTGCTGCCGATGACGCGTGCAGCACCGTC
TGCAAGCAGGAAGGCAATGGCATGGGTGGCCACTGTGTCGACGCATTGTAA
Gene >AgabiH97|116240
ATGCAACCTACCCAACTCTTCTTCGCTCTCGTCGCTCTCTGCGCCACAGCCGTCATGGCTGGACCTGCCCCCGCT
GGTGCAGTTGAAGCTCGTGGCTTCATCTGTGACTTCCTTCCTCAACCTGCTGCCGATGACGCGTGCAGCACCGTC
TGCAAGCAGGAAGGCAATGGCATGGGTGGCCACTGTGTCGGTGAGTACATAAACATGTAGCGTAGACGATTGATA
TTTACCGAGAGGTTGACAGACGGTACCTGCACCTGCTTGCACTAATTGTGAGATCAAATCGATCTCCATACGTTG
AGCATGTAAGTTTTCATTTTCATGATGAAAAGACTACGACTTATTGTATACGTGATGATTACAGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail