Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115890
Gene name
Locationscaffold_9:587713..589812
Strand+
Gene length (bp)2099
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 3.8E-07 117 384
PF07687 M20_dimer Peptidase dimerisation domain 1.1E-04 214 285

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IYS1|P20D2_HUMAN Peptidase M20 domain-containing protein 2 OS=Homo sapiens GN=PM20D2 PE=1 SV=2 47 438 3.0E-67
sp|A3KG59|P20D2_MOUSE Peptidase M20 domain-containing protein 2 OS=Mus musculus GN=Pm20d2 PE=1 SV=1 28 427 2.0E-65
sp|Q501L1|P20D2_XENTR Peptidase M20 domain-containing protein 2 OS=Xenopus tropicalis GN=pm20d2 PE=2 SV=1 47 434 4.0E-58
sp|P76052|ABGB_ECOLI p-aminobenzoyl-glutamate hydrolase subunit B OS=Escherichia coli (strain K12) GN=abgB PE=1 SV=1 40 304 2.0E-29
sp|P45493|HIPO_CAMJE Hippurate hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hipO PE=3 SV=2 52 357 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IYS1|P20D2_HUMAN Peptidase M20 domain-containing protein 2 OS=Homo sapiens GN=PM20D2 PE=1 SV=2 47 438 3.0E-67
sp|A3KG59|P20D2_MOUSE Peptidase M20 domain-containing protein 2 OS=Mus musculus GN=Pm20d2 PE=1 SV=1 28 427 2.0E-65
sp|Q501L1|P20D2_XENTR Peptidase M20 domain-containing protein 2 OS=Xenopus tropicalis GN=pm20d2 PE=2 SV=1 47 434 4.0E-58
sp|P76052|ABGB_ECOLI p-aminobenzoyl-glutamate hydrolase subunit B OS=Escherichia coli (strain K12) GN=abgB PE=1 SV=1 40 304 2.0E-29
sp|P45493|HIPO_CAMJE Hippurate hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hipO PE=3 SV=2 52 357 3.0E-12
sp|P54955|YXEP_BACSU Uncharacterized hydrolase YxeP OS=Bacillus subtilis (strain 168) GN=yxeP PE=1 SV=2 59 313 5.0E-10
sp|P44765|ABGA_HAEIN p-aminobenzoyl-glutamate hydrolase subunit A homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=abgA PE=3 SV=1 128 339 2.0E-09
sp|O34980|YTNL_BACSU Uncharacterized hydrolase YtnL OS=Bacillus subtilis (strain 168) GN=ytnL PE=3 SV=1 48 300 3.0E-09
sp|B1MZM9|DAPEL_LEUCK N-acetyldiaminopimelate deacetylase OS=Leuconostoc citreum (strain KM20) GN=LCK_01154 PE=3 SV=1 54 366 3.0E-09
sp|P80092|CBPX1_SULSO Thermostable carboxypeptidase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cpsA1 PE=1 SV=2 40 336 3.0E-09
sp|P58156|CBPX2_SULSO Thermostable carboxypeptidase 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cpsA2 PE=3 SV=1 40 336 4.0E-09
sp|P54984|Y100_SYNY3 Uncharacterized hydrolase sll0100 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0100 PE=3 SV=1 42 254 5.0E-09
sp|Q8H3C7|ILL9_ORYSJ IAA-amino acid hydrolase ILR1-like 9 OS=Oryza sativa subsp. japonica GN=ILL9 PE=2 SV=2 51 320 1.0E-08
sp|Q03CW2|DAPEL_LACC3 N-acetyldiaminopimelate deacetylase OS=Lactobacillus casei (strain ATCC 334) GN=LSEI_0096 PE=3 SV=1 55 392 2.0E-08
sp|B3W7E6|DAPEL_LACCB N-acetyldiaminopimelate deacetylase OS=Lactobacillus casei (strain BL23) GN=LCABL_00980 PE=3 SV=1 55 392 2.0E-08
sp|Q851L5|ILL3_ORYSJ IAA-amino acid hydrolase ILR1-like 3 OS=Oryza sativa subsp. japonica GN=ILL3 PE=2 SV=1 56 365 2.0E-08
sp|C5D827|DAPEL_GEOSW N-acetyldiaminopimelate deacetylase OS=Geobacillus sp. (strain WCH70) GN=GWCH70_0945 PE=3 SV=1 58 366 3.0E-08
sp|Q65K84|DAPEL_BACLD N-acetyldiaminopimelate deacetylase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=BLi01633 PE=3 SV=1 54 322 5.0E-08
sp|Q04FS2|DAPEL_OENOB N-acetyldiaminopimelate deacetylase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=OEOE_0773 PE=3 SV=1 54 314 5.0E-08
sp|Q03YE3|DAPEL_LEUMM N-acetyldiaminopimelate deacetylase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=LEUM_0669 PE=3 SV=1 54 366 6.0E-08
sp|Q8ERA3|DAPEL_OCEIH N-acetyldiaminopimelate deacetylase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB1403 PE=3 SV=1 55 366 6.0E-08
sp|B7GIC0|DAPEL_ANOFW N-acetyldiaminopimelate deacetylase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=Aflv_1903 PE=3 SV=2 62 331 1.0E-07
sp|O50173|IAAH_ENTAG Indole-3-acetyl-aspartic acid hydrolase OS=Enterobacter agglomerans GN=iaaH PE=1 SV=3 99 313 2.0E-07
sp|P54983|AMHX_BACSU Amidohydrolase AmhX OS=Bacillus subtilis (strain 168) GN=amhX PE=3 SV=3 49 289 3.0E-07
sp|B1YJ90|DAPEL_EXIS2 N-acetyldiaminopimelate deacetylase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=Exig_2019 PE=3 SV=1 62 366 1.0E-06
sp|Q7XUA8|ILL5_ORYSJ IAA-amino acid hydrolase ILR1-like 5 OS=Oryza sativa subsp. japonica GN=ILL5 PE=2 SV=1 63 192 2.0E-06
sp|Q5L145|DAPEL_GEOKA N-acetyldiaminopimelate deacetylase OS=Geobacillus kaustophilus (strain HTA426) GN=GK1050 PE=3 SV=1 58 366 2.0E-06
sp|P54968|ILR1_ARATH IAA-amino acid hydrolase ILR1 OS=Arabidopsis thaliana GN=ILR1 PE=1 SV=2 54 314 2.0E-06
sp|A7GS08|DAPEL_BACCN N-acetyldiaminopimelate deacetylase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=Bcer98_2682 PE=3 SV=1 62 366 2.0E-06
sp|Q4L6A3|Y1513_STAHJ Uncharacterized hydrolase SH1513 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1513 PE=3 SV=1 63 195 5.0E-06
sp|Q851L6|ILL4_ORYSJ IAA-amino acid hydrolase ILR1-like 4 OS=Oryza sativa subsp. japonica GN=ILL4 PE=2 SV=1 56 316 7.0E-06
sp|Q8VYX0|ILL6_ARATH IAA-amino acid hydrolase ILR1-like 6 OS=Arabidopsis thaliana GN=ILL6 PE=2 SV=2 56 192 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115890
MCEGDHEPQQSWNDAVLWHRDDKATPAPQDPHPERLYKPEVLKTIDDTINGLSEELRALSLDIHGHPELLFKEYY
AHDTYTAFMRKHGWKVTEHLHLETAWEATFEHGQGGRVIGVNSEMDALPDIGHACGHNLIGIAGVAVSLGLRAAL
EKHNIPGKIVLLGTPAEEGGDGKAILLKEGAYKGMDACLMCHPAPGPLGSVSLTSCYAREKLIVEYEGHPAHSAL
SPWEGRNALDAAVLGYVNISALRQQLKPTTRVHGIFEAVDWAVNIVPAKARFICFIRAPTRSELLPTVERVLPCF
HGAAQASGCEVKITHLSQSFDIRQNKALGDEVANIMLNKYGSIDYEWGIRYASTDFGNVSYDLPALHPSFSIPTV
PNGGNHTHDFAKSAAMIEAHKQCLVMSIALAGAGLRVLTDDAFFTEVKKAFEEDKEIRKFKDA*
Coding >AgabiH97|115890
ATGTGTGAAGGCGATCATGAACCCCAGCAATCTTGGAACGATGCGGTTTTATGGCATCGTGATGATAAGGCGACG
CCTGCTCCTCAGGATCCTCATCCAGAACGATTGTACAAACCTGAAGTGTTGAAGACCATCGATGACACGATCAAT
GGGTTGAGTGAGGAACTTAGGGCTTTAAGTCTTGATATCCACGGTCACCCTGAGCTTCTATTCAAAGAATATTAT
GCACACGACACCTACACAGCCTTTATGAGGAAACACGGATGGAAGGTTACAGAACATCTTCATCTTGAAACTGCC
TGGGAAGCGACGTTTGAACATGGGCAGGGAGGAAGAGTTATCGGGGTCAATTCTGAGATGGACGCTCTTCCGGAT
ATCGGACATGCTTGTGGTCACAATCTCATTGGAATAGCTGGTGTCGCTGTGTCTCTAGGTCTACGAGCTGCTCTC
GAGAAACATAACATTCCAGGCAAGATTGTCCTTTTAGGAACGCCTGCCGAGGAAGGTGGTGATGGAAAGGCCATT
TTGCTCAAGGAAGGTGCCTACAAAGGCATGGATGCCTGTTTGATGTGCCATCCCGCTCCTGGTCCCTTGGGATCA
GTCAGCCTCACCAGCTGCTACGCTCGAGAGAAATTGATAGTCGAATACGAAGGACATCCAGCCCATTCTGCTCTT
TCTCCTTGGGAGGGAAGAAATGCACTGGATGCAGCTGTTCTGGGTTATGTCAATATCTCAGCCCTTCGTCAACAA
CTTAAACCCACCACTCGTGTCCATGGGATTTTTGAAGCGGTCGATTGGGCAGTAAACATCGTCCCGGCCAAAGCC
CGGTTCATCTGTTTCATCCGCGCACCGACTCGTTCAGAATTGTTGCCAACTGTGGAACGAGTCCTTCCTTGTTTC
CATGGTGCAGCGCAGGCGTCTGGCTGCGAGGTCAAAATTACTCATCTGAGTCAATCATTTGACATTCGACAAAAC
AAGGCCTTGGGTGATGAAGTTGCGAATATCATGCTAAACAAGTATGGGTCCATTGACTACGAATGGGGTATCAGG
TATGCATCAACGGACTTTGGCAACGTCAGCTACGACTTACCTGCACTCCATCCGAGCTTTTCCATTCCGACAGTC
CCTAATGGTGGTAACCATACCCACGATTTCGCAAAATCCGCTGCCATGATTGAGGCTCATAAGCAATGTTTGGTT
ATGTCAATCGCACTCGCAGGTGCTGGCCTGCGCGTCCTCACCGACGACGCTTTCTTCACTGAGGTCAAAAAGGCA
TTCGAGGAGGACAAAGAAATTCGAAAGTTTAAAGATGCCTGA
Transcript >AgabiH97|115890
ATGTGTGAAGGCGATCATGAACCCCAGCAATCTTGGAACGATGCGGTTTTATGGCATCGTGATGATAAGGCGACG
CCTGCTCCTCAGGATCCTCATCCAGAACGATTGTACAAACCTGAAGTGTTGAAGACCATCGATGACACGATCAAT
GGGTTGAGTGAGGAACTTAGGGCTTTAAGTCTTGATATCCACGGTCACCCTGAGCTTCTATTCAAAGAATATTAT
GCACACGACACCTACACAGCCTTTATGAGGAAACACGGATGGAAGGTTACAGAACATCTTCATCTTGAAACTGCC
TGGGAAGCGACGTTTGAACATGGGCAGGGAGGAAGAGTTATCGGGGTCAATTCTGAGATGGACGCTCTTCCGGAT
ATCGGACATGCTTGTGGTCACAATCTCATTGGAATAGCTGGTGTCGCTGTGTCTCTAGGTCTACGAGCTGCTCTC
GAGAAACATAACATTCCAGGCAAGATTGTCCTTTTAGGAACGCCTGCCGAGGAAGGTGGTGATGGAAAGGCCATT
TTGCTCAAGGAAGGTGCCTACAAAGGCATGGATGCCTGTTTGATGTGCCATCCCGCTCCTGGTCCCTTGGGATCA
GTCAGCCTCACCAGCTGCTACGCTCGAGAGAAATTGATAGTCGAATACGAAGGACATCCAGCCCATTCTGCTCTT
TCTCCTTGGGAGGGAAGAAATGCACTGGATGCAGCTGTTCTGGGTTATGTCAATATCTCAGCCCTTCGTCAACAA
CTTAAACCCACCACTCGTGTCCATGGGATTTTTGAAGCGGTCGATTGGGCAGTAAACATCGTCCCGGCCAAAGCC
CGGTTCATCTGTTTCATCCGCGCACCGACTCGTTCAGAATTGTTGCCAACTGTGGAACGAGTCCTTCCTTGTTTC
CATGGTGCAGCGCAGGCGTCTGGCTGCGAGGTCAAAATTACTCATCTGAGTCAATCATTTGACATTCGACAAAAC
AAGGCCTTGGGTGATGAAGTTGCGAATATCATGCTAAACAAGTATGGGTCCATTGACTACGAATGGGGTATCAGG
TATGCATCAACGGACTTTGGCAACGTCAGCTACGACTTACCTGCACTCCATCCGAGCTTTTCCATTCCGACAGTC
CCTAATGGTGGTAACCATACCCACGATTTCGCAAAATCCGCTGCCATGATTGAGGCTCATAAGCAATGTTTGGTT
ATGTCAATCGCACTCGCAGGTGCTGGCCTGCGCGTCCTCACCGACGACGCTTTCTTCACTGAGGTCAAAAAGGCA
TTCGAGGAGGACAAAGAAATTCGAAAGTTTAAAGATGCCTGA
Gene >AgabiH97|115890
ATGTGTGAAGGCGATCATGAACCCCAGCAATCTTGGAACGATGCGGTTTTATGGCATCGTGATGATAAGGCGACG
CCTGCTCCTCAGGATCCTCATCCAGAACGATTGTACAAACCTGAAGTGTTGAAGACCATCGATGACACGATCAAT
GGGTTGAGTGAGGAACTTAGGGCTTTAAGTCTTGATATCCACGGTAAGTCGATGTAATTTGACATAGTAAATGAT
CGGGAACCCTGAAAACGACCCGGTTAGGTCACCCTGAGCTTCTATTCAAAGAATAGTATGTTTCGTCGACTTTGA
CCGTCTACTTTTCTCAGACGATCTGGAAGTTATGCACACGACACCTACACAGCCTTTATGAGGAAACACGGATGG
AAGGTTACAGAACATCTTCATCTTGAAACTGCCTGGGAAGCGACGTTTGAACATGGGCAGGGAGGAAGAGTTATC
GGGGTCAATTCTGAGGTGCGCATACCTGACTCCTGATAATACTTCGTTCTTTATAGGACTTTTTTGCCATACAGA
TGGACGCTCTTCCGGATATCGGACATGCTTGTGGTCACAATCTCATTGGAATAGCTGGTATGTTTTGCGTTTAGC
GATAGGATGAATTCCACATCTCATCTATCATTCCAGGTGTCGCTGTGTCTCTAGGTCTACGAGCTGCTCTCGAGA
AACATAACATTCCAGGCAAGATTGTCCTTTTAGGAACGCCTGGTTCGTACTGTCTTGTAAATCAGCGTACACTCT
TCGCTTACAACACCGACTTTAGCCGAGGAAGGTGGTGATGGAAAGGCCATTTTGCTCAAGGAAGGTGCCTACAAA
GGCATGGATGCCTGTTTGATGTGATTTGTTTTTTGTTCATTGATTCCAGGATATAGACTGATGCGATTCAAAGGT
GCCATCCCGCTCCTGGTCCCTTGGGATCAGTCAGCCTCACCAGCTGCTACGCTCGAGAGAAATTGATAGTCGAAT
ACGAAGGACATCCGTAAGGAATTTCACACCTGTTTTTCATGATATAAAGGGGTTAAATTTACTTTTTGCTTATTT
ATTCTAGAGCCCATTCTGCTCTTTCTCCTTGGGAGGGAAGAAATGCACTGGATGCAGCTGTTCTGGGTTATGTCA
ATATCTCAGCCCTTCGTCAACAACTTAAACCCACCACTCGTGTCCATGGGATTTTTGAAGCGGTCGATTGGGCAG
TAAACAGTGAGTCTTGATTTCAAGTTCAAATGATTACTTTCTAACGTAGTTCTCAAGTCGTCCCGGCCAAAGCCC
GGTTCATGTATGTTAGGACCTTTCATTCCACTACTCTCCCTCTAACTCGAAATCCCATTTTGATACCTAGCTGTT
TCATCCGCGCACCGACTCGTTCAGAATTGTTGCCAACTGTGGAACGAGTCCTTCCTTGTTTCCAGTACGTTGAAG
AAGTCGTGCTTTTGGAATATAGGCACTGAATTTTTTTTTAGTGGTGCAGCGCAGGCGTCTGGCTGCGAGGTCAAA
ATTACTCATCTGAGTCAATCATTTGACATTCGACAAAACAAGGCCTTGGGTATGTTATATGTTTGACTGTGAGAT
GAGGTAACTGTATCCGACTGTTGAACAGGTGATGAAGTTGCGAATATCATGCTAAACAAGTATGGGTCCATTGAC
TACGAATGGGGTATCAGGTATGCATCAACGGACTTTGTAAGTATGCTCCTACTCTCTTCCCATTTTTCATATTTA
CACGTTGATATGTAGGGCAACGTCAGCTACGGCAAGTACTAACTTTGAGCTCAGGCCAATTTATATTCTGACATC
CTGAGCAGACTTACCTGCACTCCATCCGAGCTTTTCCATTCCGACAGTCCCTAATGGTGGTAACCATACCCACGA
TTTCGCAAAATCCGCTGCCATGATTGAGGCTCATAAGCAATGTTTGGTTATGTCAATCGCACTCGCAGGTGCTGG
CCTGCGCGTCCTCACCGACGACGCTTTCTTCACTGAGGTAATTATACATAGTTTTGCCGTGGATTGACGAGGCTA
AATACTGTTTATCGAATCAGGTCAAAAAGGCATTCGAGGAGGACAAAGAAATTCGAAAGTTTAAAGATGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail