Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115880
Gene name
Locationscaffold_9:585100..587163
Strand+
Gene length (bp)2063
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07687 M20_dimer Peptidase dimerisation domain 5.7E-09 213 289
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 9.9E-07 120 362

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IYS1|P20D2_HUMAN Peptidase M20 domain-containing protein 2 OS=Homo sapiens GN=PM20D2 PE=1 SV=2 49 437 2.0E-72
sp|A3KG59|P20D2_MOUSE Peptidase M20 domain-containing protein 2 OS=Mus musculus GN=Pm20d2 PE=1 SV=1 24 423 2.0E-70
sp|Q501L1|P20D2_XENTR Peptidase M20 domain-containing protein 2 OS=Xenopus tropicalis GN=pm20d2 PE=2 SV=1 45 423 1.0E-66
sp|P76052|ABGB_ECOLI p-aminobenzoyl-glutamate hydrolase subunit B OS=Escherichia coli (strain K12) GN=abgB PE=1 SV=1 36 335 6.0E-26
sp|P54955|YXEP_BACSU Uncharacterized hydrolase YxeP OS=Bacillus subtilis (strain 168) GN=yxeP PE=1 SV=2 46 299 3.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IYS1|P20D2_HUMAN Peptidase M20 domain-containing protein 2 OS=Homo sapiens GN=PM20D2 PE=1 SV=2 49 437 2.0E-72
sp|A3KG59|P20D2_MOUSE Peptidase M20 domain-containing protein 2 OS=Mus musculus GN=Pm20d2 PE=1 SV=1 24 423 2.0E-70
sp|Q501L1|P20D2_XENTR Peptidase M20 domain-containing protein 2 OS=Xenopus tropicalis GN=pm20d2 PE=2 SV=1 45 423 1.0E-66
sp|P76052|ABGB_ECOLI p-aminobenzoyl-glutamate hydrolase subunit B OS=Escherichia coli (strain K12) GN=abgB PE=1 SV=1 36 335 6.0E-26
sp|P54955|YXEP_BACSU Uncharacterized hydrolase YxeP OS=Bacillus subtilis (strain 168) GN=yxeP PE=1 SV=2 46 299 3.0E-15
sp|O34980|YTNL_BACSU Uncharacterized hydrolase YtnL OS=Bacillus subtilis (strain 168) GN=ytnL PE=3 SV=1 35 309 4.0E-14
sp|P54983|AMHX_BACSU Amidohydrolase AmhX OS=Bacillus subtilis (strain 168) GN=amhX PE=3 SV=3 45 286 1.0E-12
sp|P58156|CBPX2_SULSO Thermostable carboxypeptidase 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cpsA2 PE=3 SV=1 36 332 5.0E-12
sp|P80092|CBPX1_SULSO Thermostable carboxypeptidase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cpsA1 PE=1 SV=2 36 332 1.0E-11
sp|P54984|Y100_SYNY3 Uncharacterized hydrolase sll0100 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0100 PE=3 SV=1 59 279 2.0E-11
sp|B1MZM9|DAPEL_LEUCK N-acetyldiaminopimelate deacetylase OS=Leuconostoc citreum (strain KM20) GN=LCK_01154 PE=3 SV=1 50 332 5.0E-11
sp|Q851L5|ILL3_ORYSJ IAA-amino acid hydrolase ILR1-like 3 OS=Oryza sativa subsp. japonica GN=ILL3 PE=2 SV=1 48 309 2.0E-10
sp|Q8S9S4|ILL1_ORYSJ IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sativa subsp. japonica GN=ILL1 PE=2 SV=1 48 309 9.0E-10
sp|P45493|HIPO_CAMJE Hippurate hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hipO PE=3 SV=2 35 346 1.0E-09
sp|Q84XG9|ILL1_ORYSI IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sativa subsp. indica GN=ILL1 PE=2 SV=1 48 309 3.0E-09
sp|P44765|ABGA_HAEIN p-aminobenzoyl-glutamate hydrolase subunit A homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=abgA PE=3 SV=1 81 353 5.0E-09
sp|Q8H3C7|ILL9_ORYSJ IAA-amino acid hydrolase ILR1-like 9 OS=Oryza sativa subsp. japonica GN=ILL9 PE=2 SV=2 47 305 1.0E-08
sp|O34916|DAPEL_BACSU N-acetyldiaminopimelate deacetylase OS=Bacillus subtilis (strain 168) GN=ykuR PE=1 SV=1 50 366 2.0E-08
sp|Q03CW2|DAPEL_LACC3 N-acetyldiaminopimelate deacetylase OS=Lactobacillus casei (strain ATCC 334) GN=LSEI_0096 PE=3 SV=1 51 332 3.0E-08
sp|B3W7E6|DAPEL_LACCB N-acetyldiaminopimelate deacetylase OS=Lactobacillus casei (strain BL23) GN=LCABL_00980 PE=3 SV=1 51 332 4.0E-08
sp|Q8H3C9|ILL7_ORYSJ IAA-amino acid hydrolase ILR1-like 7 OS=Oryza sativa subsp. japonica GN=ILL7 PE=2 SV=1 47 309 5.0E-08
sp|Q851L6|ILL4_ORYSJ IAA-amino acid hydrolase ILR1-like 4 OS=Oryza sativa subsp. japonica GN=ILL4 PE=2 SV=1 48 309 6.0E-08
sp|A7Z433|DAPEL_BACMF N-acetyldiaminopimelate deacetylase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=RBAM_013960 PE=3 SV=1 50 366 6.0E-08
sp|Q65K84|DAPEL_BACLD N-acetyldiaminopimelate deacetylase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=BLi01633 PE=3 SV=1 50 332 8.0E-08
sp|A8FCN2|DAPEL_BACP2 N-acetyldiaminopimelate deacetylase OS=Bacillus pumilus (strain SAFR-032) GN=BPUM_1316 PE=3 SV=1 50 332 1.0E-07
sp|C5D827|DAPEL_GEOSW N-acetyldiaminopimelate deacetylase OS=Geobacillus sp. (strain WCH70) GN=GWCH70_0945 PE=3 SV=1 54 379 1.0E-07
sp|A8YUT2|DAPEL_LACH4 N-acetyldiaminopimelate deacetylase OS=Lactobacillus helveticus (strain DPC 4571) GN=lhv_0907 PE=3 SV=1 51 335 2.0E-07
sp|P54969|ILL1_ARATH IAA-amino acid hydrolase ILR1-like 1 OS=Arabidopsis thaliana GN=ILL1 PE=2 SV=1 50 217 2.0E-07
sp|P54968|ILR1_ARATH IAA-amino acid hydrolase ILR1 OS=Arabidopsis thaliana GN=ILR1 PE=1 SV=2 48 310 2.0E-07
sp|Q8H3C8|ILL8_ORYSJ IAA-amino acid hydrolase ILR1-like 8 OS=Oryza sativa subsp. japonica GN=ILL8 PE=2 SV=1 52 319 5.0E-07
sp|P55663|Y4TI_RHISN Uncharacterized hydrolase y4tI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01500 PE=3 SV=1 45 382 5.0E-07
sp|P37112|AMAA_GEOSE N-acyl-L-amino acid amidohydrolase OS=Geobacillus stearothermophilus GN=amaA PE=1 SV=1 59 188 6.0E-07
sp|Q5L145|DAPEL_GEOKA N-acetyldiaminopimelate deacetylase OS=Geobacillus kaustophilus (strain HTA426) GN=GK1050 PE=3 SV=1 54 366 6.0E-07
sp|Q8VYX0|ILL6_ARATH IAA-amino acid hydrolase ILR1-like 6 OS=Arabidopsis thaliana GN=ILL6 PE=2 SV=2 20 188 7.0E-07
sp|Q731Y6|DAPEL_BACC1 N-acetyldiaminopimelate deacetylase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_4029 PE=3 SV=1 58 332 9.0E-07
sp|B7GIC0|DAPEL_ANOFW N-acetyldiaminopimelate deacetylase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=Aflv_1903 PE=3 SV=2 58 332 1.0E-06
sp|Q7XUA8|ILL5_ORYSJ IAA-amino acid hydrolase ILR1-like 5 OS=Oryza sativa subsp. japonica GN=ILL5 PE=2 SV=1 59 188 2.0E-06
sp|Q4L6A3|Y1513_STAHJ Uncharacterized hydrolase SH1513 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1513 PE=3 SV=1 59 178 2.0E-06
sp|C1EPZ4|DAPEL_BACC3 N-acetyldiaminopimelate deacetylase OS=Bacillus cereus (strain 03BB102) GN=BCA_4085 PE=3 SV=1 58 332 2.0E-06
sp|Q8ERA3|DAPEL_OCEIH N-acetyldiaminopimelate deacetylase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB1403 PE=3 SV=1 51 362 2.0E-06
sp|B7HMV1|DAPEL_BACC7 N-acetyldiaminopimelate deacetylase OS=Bacillus cereus (strain AH187) GN=BCAH187_A4100 PE=3 SV=1 58 332 2.0E-06
sp|D5E0A1|DAPEL_BACMQ N-acetyldiaminopimelate deacetylase OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=BMQ_1331 PE=1 SV=1 50 309 3.0E-06
sp|B7JKV4|DAPEL_BACC0 N-acetyldiaminopimelate deacetylase OS=Bacillus cereus (strain AH820) GN=BCAH820_3995 PE=3 SV=1 58 332 3.0E-06
sp|Q635U8|DAPEL_BACCZ N-acetyldiaminopimelate deacetylase OS=Bacillus cereus (strain ZK / E33L) GN=BCE33L3738 PE=3 SV=1 58 332 3.0E-06
sp|C3P6Y7|DAPEL_BACAA N-acetyldiaminopimelate deacetylase OS=Bacillus anthracis (strain A0248) GN=BAA_4215 PE=3 SV=1 58 332 3.0E-06
sp|A0RHZ2|DAPEL_BACAH N-acetyldiaminopimelate deacetylase OS=Bacillus thuringiensis (strain Al Hakam) GN=BALH_3602 PE=3 SV=1 58 332 3.0E-06
sp|Q81MQ3|DAPEL_BACAN N-acetyldiaminopimelate deacetylase OS=Bacillus anthracis GN=BA_4193 PE=3 SV=1 58 332 3.0E-06
sp|Q5FKR0|DAPEL_LACAC N-acetyldiaminopimelate deacetylase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=LBA0853 PE=3 SV=1 51 247 3.0E-06
sp|C3LI46|DAPEL_BACAC N-acetyldiaminopimelate deacetylase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=BAMEG_4233 PE=3 SV=1 58 332 3.0E-06
sp|B9IW60|DAPEL_BACCQ N-acetyldiaminopimelate deacetylase OS=Bacillus cereus (strain Q1) GN=BCQ_3769 PE=3 SV=1 58 332 4.0E-06
sp|Q9SWX9|ILL5_ARATH IAA-amino acid hydrolase ILR1-like 5 OS=Arabidopsis thaliana GN=ILL5 PE=3 SV=1 46 309 4.0E-06
sp|A7GS08|DAPEL_BACCN N-acetyldiaminopimelate deacetylase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=Bcer98_2682 PE=3 SV=1 58 327 4.0E-06
sp|Q6HEI5|DAPEL_BACHK N-acetyldiaminopimelate deacetylase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_3722 PE=3 SV=1 58 332 5.0E-06
sp|Q04FS2|DAPEL_OENOB N-acetyldiaminopimelate deacetylase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=OEOE_0773 PE=3 SV=1 48 310 5.0E-06
sp|B2G6M8|DAPEL_LACRJ N-acetyldiaminopimelate deacetylase OS=Lactobacillus reuteri (strain JCM 1112) GN=LAR_0594 PE=3 SV=1 50 325 6.0E-06
sp|Q8CSM6|Y1078_STAES Uncharacterized hydrolase SE_1078 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1078 PE=3 SV=1 50 179 6.0E-06
sp|A5VJ57|DAPEL_LACRD N-acetyldiaminopimelate deacetylase OS=Lactobacillus reuteri (strain DSM 20016) GN=Lreu_0614 PE=3 SV=1 50 325 6.0E-06
sp|Q2FYN6|Y1399_STAA8 Uncharacterized hydrolase SAOUHSC_01399 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01399 PE=3 SV=1 59 179 9.0E-06
sp|Q6G9G3|Y1339_STAAS Uncharacterized hydrolase SAS1339 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1339 PE=3 SV=1 59 179 9.0E-06
sp|Q2FH40|Y1291_STAA3 Uncharacterized hydrolase SAUSA300_1291 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1291 PE=3 SV=1 59 179 9.0E-06
sp|Q8NWS3|Y1286_STAAW Uncharacterized hydrolase MW1286 OS=Staphylococcus aureus (strain MW2) GN=MW1286 PE=3 SV=1 59 179 9.0E-06
sp|Q99U87|Y1398_STAAM Uncharacterized hydrolase SAV1398 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1398 PE=3 SV=1 59 212 1.0E-05
sp|Q7A5P6|Y1230_STAAN Uncharacterized hydrolase SA1230 OS=Staphylococcus aureus (strain N315) GN=SA1230 PE=3 SV=1 59 212 1.0E-05
sp|Q5HG22|Y1433_STAAC Uncharacterized hydrolase SACOL1433 OS=Staphylococcus aureus (strain COL) GN=SACOL1433 PE=3 SV=1 59 179 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115880
MSGQPQKTWTNDPWRPEDKWTPAPKDPHPERIYKPEVLKTIEGTIQGFSDELRALSLDIHAHPELSFKEYYAHDA
YTKFMKEHGWNVKEHHHLETAWEATFEYGQGGRVIGINSEMDALDGIGHACGHNLIGIAGVAVSLGLRAALQKHD
IPGKIVLLGTPAEESGNGKVDLLEEGAYEGMDVCLMCHPAPGPLGSISLSGSLAIQPILTEYEGHTAHASLSPWE
GRNALDAAILAYNNISALRQQIKPTHRIHGIFEGQDWAPNIIPDKAKFTCLVRAPTRAEMKETATRVYPCFEAGG
LATGCKVTITPVGEIWELRQNKALSDEVANIILNHHGSIDYGWGISGASTDFGNVSYALPSLHPGFAIPTVPNGG
NHTREFAKAAATVEAHKQCLIISIALAGTAIRVLTDDTYFEEVKKAFEEDEEIRKLKTQLQQ*
Coding >AgabiH97|115880
ATGTCAGGCCAGCCACAGAAAACCTGGACCAATGACCCATGGCGACCAGAAGATAAATGGACCCCAGCTCCGAAG
GACCCTCATCCCGAGCGTATATACAAACCCGAAGTATTGAAGACGATTGAAGGAACAATCCAAGGATTTAGCGAT
GAGCTCAGGGCCCTAAGCTTGGACATCCATGCGCATCCCGAACTTAGTTTCAAGGAATATTATGCACATGACGCT
TACACGAAATTCATGAAAGAGCACGGATGGAATGTCAAGGAGCACCACCATCTTGAGACTGCTTGGGAGGCAACC
TTCGAATACGGTCAAGGAGGGAGAGTGATCGGTATAAACTCAGAGATGGACGCCCTGGATGGAATTGGACACGCC
TGTGGTCACAATTTGATTGGTATCGCGGGTGTTGCTGTTTCGCTTGGATTGCGCGCTGCCCTGCAAAAACACGAC
ATACCTGGCAAGATCGTCCTTCTAGGAACACCAGCCGAGGAAAGTGGCAATGGAAAAGTCGATTTACTCGAGGAA
GGAGCCTACGAAGGCATGGACGTTTGCCTGATGTGCCATCCGGCCCCTGGTCCCCTGGGATCTATCAGTCTCAGT
GGCAGCCTTGCCATTCAACCAATACTTACAGAATACGAGGGCCATACTGCCCATGCCTCACTTTCACCCTGGGAG
GGCAGGAACGCATTAGATGCTGCAATCTTGGCGTACAATAATATTTCTGCTCTTCGCCAACAAATCAAACCGACG
CATCGCATCCACGGAATTTTCGAAGGGCAAGATTGGGCGCCTAACATCATCCCGGATAAGGCTAAATTTACTTGC
CTCGTCCGTGCTCCTACGCGCGCAGAAATGAAAGAGACTGCAACAAGAGTTTATCCGTGTTTCGAGGCTGGTGGG
TTGGCGACTGGCTGCAAAGTTACGATCACTCCAGTTGGCGAAATATGGGAACTCCGTCAGAACAAAGCTTTGTCG
GATGAAGTTGCGAACATTATCCTGAATCATCATGGATCCATCGATTATGGGTGGGGCATTAGCGGTGCCTCGACA
GATTTTGGAAACGTCTCTTATGCCTTACCTTCCCTTCACCCGGGTTTCGCCATCCCTACAGTTCCCAATGGTGGT
AATCACACCCGCGAATTTGCGAAAGCTGCGGCTACAGTTGAGGCACATAAACAATGTCTGATAATTTCCATCGCA
CTTGCGGGTACAGCAATCCGAGTCCTCACCGATGACACTTATTTTGAAGAGGTCAAAAAGGCCTTCGAAGAAGAC
GAAGAGATTCGAAAATTGAAAACTCAACTCCAACAGTAA
Transcript >AgabiH97|115880
ATGTCAGGCCAGCCACAGAAAACCTGGACCAATGACCCATGGCGACCAGAAGATAAATGGACCCCAGCTCCGAAG
GACCCTCATCCCGAGCGTATATACAAACCCGAAGTATTGAAGACGATTGAAGGAACAATCCAAGGATTTAGCGAT
GAGCTCAGGGCCCTAAGCTTGGACATCCATGCGCATCCCGAACTTAGTTTCAAGGAATATTATGCACATGACGCT
TACACGAAATTCATGAAAGAGCACGGATGGAATGTCAAGGAGCACCACCATCTTGAGACTGCTTGGGAGGCAACC
TTCGAATACGGTCAAGGAGGGAGAGTGATCGGTATAAACTCAGAGATGGACGCCCTGGATGGAATTGGACACGCC
TGTGGTCACAATTTGATTGGTATCGCGGGTGTTGCTGTTTCGCTTGGATTGCGCGCTGCCCTGCAAAAACACGAC
ATACCTGGCAAGATCGTCCTTCTAGGAACACCAGCCGAGGAAAGTGGCAATGGAAAAGTCGATTTACTCGAGGAA
GGAGCCTACGAAGGCATGGACGTTTGCCTGATGTGCCATCCGGCCCCTGGTCCCCTGGGATCTATCAGTCTCAGT
GGCAGCCTTGCCATTCAACCAATACTTACAGAATACGAGGGCCATACTGCCCATGCCTCACTTTCACCCTGGGAG
GGCAGGAACGCATTAGATGCTGCAATCTTGGCGTACAATAATATTTCTGCTCTTCGCCAACAAATCAAACCGACG
CATCGCATCCACGGAATTTTCGAAGGGCAAGATTGGGCGCCTAACATCATCCCGGATAAGGCTAAATTTACTTGC
CTCGTCCGTGCTCCTACGCGCGCAGAAATGAAAGAGACTGCAACAAGAGTTTATCCGTGTTTCGAGGCTGGTGGG
TTGGCGACTGGCTGCAAAGTTACGATCACTCCAGTTGGCGAAATATGGGAACTCCGTCAGAACAAAGCTTTGTCG
GATGAAGTTGCGAACATTATCCTGAATCATCATGGATCCATCGATTATGGGTGGGGCATTAGCGGTGCCTCGACA
GATTTTGGAAACGTCTCTTATGCCTTACCTTCCCTTCACCCGGGTTTCGCCATCCCTACAGTTCCCAATGGTGGT
AATCACACCCGCGAATTTGCGAAAGCTGCGGCTACAGTTGAGGCACATAAACAATGTCTGATAATTTCCATCGCA
CTTGCGGGTACAGCAATCCGAGTCCTCACCGATGACACTTATTTTGAAGAGGTCAAAAAGGCCTTCGAAGAAGAC
GAAGAGATTCGAAAATTGAAAACTCAACTCCAACAGTAA
Gene >AgabiH97|115880
ATGTCAGGCCAGCCACAGAAAACCTGGACCAATGACCCATGGCGACCAGAAGATAAATGGACCCCAGCTCCGAAG
GACCCTCATCCCGAGCGTATATACAAACCCGAAGTATTGAAGACGATTGAAGGAACAATCCAAGGATTTAGCGAT
GAGCTCAGGGCCCTAAGCTTGGACATCCATGGTACGTAATGATTGAAATTGATCCGTTCCTAAGTCTCTTCTGAC
CAACGCGCTGCCCATTGCCTAATTCCGTAGCGCATCCCGAACTTAGTTTCAAGGAATAGTGCGTCTTCGAACACT
TTACCTGATACAGGCTTACCATACGATGGTAGTTATGCACATGACGCTTACACGAAATTCATGAAAGAGCACGGA
TGGAATGTCAAGGAGCACCACCATCTTGAGACTGCTTGGGAGGCAACCTTCGAATACGGTCAAGGAGGGAGAGTG
ATCGGTATAAACTCAGAGGTATTCGAACCAGTCTCTCCCACAATTATTCCGTAAAACAATCGTCTCTCCAGATGG
ACGCCCTGGATGGAATTGGACACGCCTGTGGTCACAATTTGATTGGTATCGCGGGTATGTTCAGTCTTGAAATAG
CAGATCTCTCTACTAATTGCAAAAGGTGTTGCTGTTTCGCTTGGATTGCGCGCTGCCCTGCAAAAACACGACATA
CCTGGCAAGATCGTCCTTCTAGGAACACCAGGTATGTGTCTACTTTTTCGATAATTCACCACTCTGTAATTTGTT
GAAATCGTATAAACAGCCGAGGAAAGTGGCAATGGAAAAGTCGATTTACTCGAGGAAGGAGCCTACGAAGGCATG
GACGTTTGCCTGATGTACTGCTGTATTCGTTCCAAAGATTCAGAAACTGATGGTTGTAAATCTTTTGAAGGTGCC
ATCCGGCCCCTGGTCCCCTGGGATCTATCAGTCTCAGTGGCAGCCTTGCCATTCAACCAATACTTACAGAATACG
AGGGCCATACGTTCGTTCTCTCTCTCGCACAACTATGTATTGAGTTGATCCTATTACAGTGCCCATGCCTCACTT
TCACCCTGGGAGGGCAGGAACGCATTAGATGCTGCAATCTTGGCGTACAATAATATTTCTGCTCTTCGCCAACAA
ATCAAACCGACGCATCGCATCCACGGAATTTTCGAAGGGCAAGATTGGGCGCCTAACAGTTTGTCACGTCTCTCG
ATCCTTTGATTCATCTCATGAATTCTATAACATATAGTCATCCCGGATAAGGCTAAATTTACGTACGTCGTCTGC
CAACGACATGATGCCCTTTTCACGCAGCAGTGGGCAGTTGCCTCGTCCGTGCTCCTACGCGCGCAGAAATGAAAG
AGACTGCAACAAGAGTTTATCCGTGTTTCGAGTATGTCATATGCCAACCTTCTTCCAGTTCGTTGCTTATTGTCT
CCCAGGGCTGGTGGGTTGGCGACTGGCTGCAAAGTTACGATCACTCCAGTTGGCGAAATATGGGAACTCCGTCAG
AACAAAGCTTTGTGTAAGATATTACAGTCACATTGGAGCACAACTAGCTCAGACCCCTACCCCTCACAGCGGATG
AAGTTGCGAACATTATCCTGAATCATCATGGATCCATCGATTATGGGTGGGGCATTAGCGGTGCCTCGACAGATT
TTGTGAGCAAATAAGCAACCGCCCAATCCTCTTACTGATATGTTCTTATTGCAGGGAAACGTCTCTTATGGTAAA
TCAGACACACATGTTACCCCCCGATCTAATTGTTGTACAGCCTTACCTTCCCTTCACCCGGGTTTCGCCATCCCT
ACAGTTCCCAATGGTGGTAATCACACCCGCGAATTTGCGAAAGCTGCGGCTACAGTTGAGGCACATAAACAATGT
CTGATAATTTCCATCGCACTTGCGGGTACAGCAATCCGAGTCCTCACCGATGACACTTATTTTGAAGAGGTAACA
CGAATTTTTCATGCGCATAATTGGCGCATACTGATGTAACCATTGCTTAGGTCAAAAAGGCCTTCGAAGAAGACG
AAGAGATTCGAAAATTGAAAACTCAACTCCAACAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail