© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|115830 |
| Gene name | |
| Location | scaffold_9:573380..573880 |
| Strand | - |
| Gene length (bp) | 500 |
| Transcript length (bp) | 276 |
| Coding sequence length (bp) | 276 |
| Protein length (aa) | 92 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF02939 | UcrQ | UcrQ family | 1.8E-28 | 10 | 85 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P50523|QCR8_SCHPO | Cytochrome b-c1 complex subunit 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr8 PE=3 SV=1 | 3 | 89 | 1.0E-15 |
| sp|P08525|QCR8_YEAST | Cytochrome b-c1 complex subunit 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR8 PE=1 SV=2 | 2 | 64 | 4.0E-10 |
| sp|P49346|QCR8_KLULA | Cytochrome b-c1 complex subunit 8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR8 PE=3 SV=1 | 2 | 64 | 3.0E-09 |
| sp|P48503|QCR8_NEUCR | Cytochrome b-c1 complex subunit 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-8 PE=1 SV=1 | 7 | 84 | 6.0E-09 |
| sp|O14949|QCR8_HUMAN | Cytochrome b-c1 complex subunit 8 OS=Homo sapiens GN=UQCRQ PE=1 SV=4 | 19 | 82 | 8.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005750 | mitochondrial respiratory chain complex III | Yes |
| GO:0006122 | mitochondrial electron transport, ubiquinol to cytochrome c | Yes |
| GO:0008152 | metabolic process | No |
| GO:0098800 | inner mitochondrial membrane protein complex | No |
| GO:0019646 | aerobic electron transport chain | No |
| GO:0005575 | cellular_component | No |
| GO:0098798 | mitochondrial protein-containing complex | No |
| GO:0006091 | generation of precursor metabolites and energy | No |
| GO:0098803 | respiratory chain complex | No |
| GO:0009060 | aerobic respiration | No |
| GO:0045275 | respiratory chain complex III | No |
| GO:0008150 | biological_process | No |
| GO:0098796 | membrane protein complex | No |
| GO:0022900 | electron transport chain | No |
| GO:1902495 | transmembrane transporter complex | No |
| GO:1902494 | catalytic complex | No |
| GO:0022904 | respiratory electron transport chain | No |
| GO:1990351 | transporter complex | No |
| GO:0045333 | cellular respiration | No |
| GO:0032991 | protein-containing complex | No |
| GO:0070069 | cytochrome complex | No |
| GO:0009987 | cellular process | No |
| GO:0015980 | energy derivation by oxidation of organic compounds | No |
| GO:1990204 | oxidoreductase complex | No |
| GO:0044237 | cellular metabolic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 36 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 55 | 72 | 17 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 746.27 | 420.67 | 1071.87 |
| Initials | Initials knots | 373.79 | 200.88 | 546.70 |
| Pileal_Stipeal_center | Stage I stipe center | 1145.15 | 682.05 | 1608.24 |
| Pileal_Stipeal_shell | Stage I stipe shell | 1454.33 | 874.33 | 2034.34 |
| DIF_stipe_center | Stage II stipe center | 1282.46 | 769.61 | 1795.31 |
| DIF_stipe_shell | Stage II stipe shell | 1089.42 | 648.26 | 1530.59 |
| DIF_stipe_skin | Stage II stipe skin | 1091.06 | 649.14 | 1532.98 |
| DIF_cap_skin | Stage II cap skin | 1671.48 | 1007.93 | 2335.03 |
| DIF_cap_tissue | Stage II cap tissue | 1456.16 | 872.22 | 2040.09 |
| DIF_gill_tissue | Stage II gill tissue | 1492.69 | 900.38 | 2085.00 |
| YFB_stipe_center | Young fruiting body stipe center | 1027.71 | 613.70 | 1441.71 |
| YFB_stipe_shell | Young fruiting body stipe shell | 994.94 | 593.71 | 1396.18 |
| YFB_stipe_skin | Young fruiting body stipe skin | 1142.81 | 684.58 | 1601.03 |
| YFB_cap_skin | Young fruiting body cap skin | 1596.97 | 961.91 | 2232.03 |
| YFB_cap_tissue | Young fruiting body cap tissue | 1197.12 | 718.07 | 1676.18 |
| YFB_gill_tissue | Young fruiting body gill tissue | 1189.57 | 713.08 | 1666.06 |
| YFB_veil | Young fruiting body veil | 1239.49 | 735.60 | 1743.39 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.012577 | yes |
| Casing | YFB_stipe_center | 0.351165 | no |
| Casing | YFB_stipe_shell | 0.425166 | no |
| Casing | YFB_stipe_skin | 0.172824 | no |
| Casing | YFB_cap_skin | 0.005302 | yes |
| Casing | YFB_cap_tissue | 0.119465 | no |
| Casing | YFB_gill_tissue | 0.122322 | no |
| Casing | YFB_veil | 0.090496 | no |
| Casing | Initials | 0.018896 | yes |
| Casing | Pileal_Stipeal_center | 0.172692 | no |
| Casing | Pileal_Stipeal_shell | 0.017226 | yes |
| Casing | DIF_stipe_center | 0.063760 | no |
| Casing | DIF_stipe_shell | 0.243427 | no |
| Casing | DIF_stipe_skin | 0.246295 | no |
| Casing | DIF_cap_skin | 0.002525 | yes |
| Casing | DIF_cap_tissue | 0.018344 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.203278 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.159859 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.424565 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.891074 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.529041 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.525127 | no |
| DIF_gill_tissue | YFB_veil | 0.620938 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.954155 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.815725 | no |
| YFB_stipe_center | YFB_cap_skin | 0.113185 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.710632 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.725605 | no |
| YFB_stipe_center | YFB_veil | 0.620893 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.742631 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.085045 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.627276 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.648401 | no |
| YFB_stipe_shell | YFB_veil | 0.540112 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.280261 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.929458 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.942264 | no |
| YFB_stipe_skin | YFB_veil | 0.868386 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.366628 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.362560 | no |
| YFB_cap_skin | YFB_veil | 0.453780 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.990921 | no |
| YFB_cap_tissue | YFB_veil | 0.948740 | no |
| YFB_gill_tissue | YFB_veil | 0.939640 | no |
| Initials | DIF_gill_tissue | 0.000613 | yes |
| Initials | YFB_stipe_center | 0.000613 | yes |
| Initials | YFB_stipe_shell | 0.000613 | yes |
| Initials | YFB_stipe_skin | 0.000613 | yes |
| Initials | YFB_cap_skin | 0.000613 | yes |
| Initials | YFB_cap_tissue | 0.000613 | yes |
| Initials | YFB_gill_tissue | 0.000613 | yes |
| Initials | YFB_veil | 0.000613 | yes |
| Initials | Pileal_Stipeal_center | 0.000613 | yes |
| Initials | Pileal_Stipeal_shell | 0.000613 | yes |
| Initials | DIF_stipe_center | 0.000613 | yes |
| Initials | DIF_stipe_shell | 0.000613 | yes |
| Initials | DIF_stipe_skin | 0.000613 | yes |
| Initials | DIF_cap_skin | 0.000613 | yes |
| Initials | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.423618 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.811248 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.739388 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.996612 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.281825 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.931940 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.943786 | no |
| Pileal_Stipeal_center | YFB_veil | 0.870336 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.497327 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.798401 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.924260 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.926445 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.196632 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.488180 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.961456 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.264200 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.209483 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.498965 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.841568 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.610881 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.601985 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.695697 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.773596 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.376076 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.387601 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.741131 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.997429 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.702572 | no |
| DIF_stipe_center | YFB_stipe_center | 0.534143 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.458582 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.795508 | no |
| DIF_stipe_center | YFB_cap_skin | 0.532207 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.889878 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.880358 | no |
| DIF_stipe_center | YFB_veil | 0.949586 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.685681 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.685431 | no |
| DIF_stipe_center | DIF_cap_skin | 0.419263 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.765212 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.314250 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.912124 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.853742 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.928633 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.197467 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.843826 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.859199 | no |
| DIF_stipe_shell | YFB_veil | 0.768246 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.997403 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.132274 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.374879 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.318159 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.909006 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.849265 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.931328 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.197235 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.845771 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.861155 | no |
| DIF_stipe_skin | YFB_veil | 0.770768 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.129695 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.374483 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.793658 | no |
| DIF_cap_skin | YFB_stipe_center | 0.075556 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.054982 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.195928 | no |
| DIF_cap_skin | YFB_cap_skin | 0.928947 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.271949 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.267865 | no |
| DIF_cap_skin | YFB_veil | 0.348565 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.739359 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.963818 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.247911 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.193627 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.484085 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.841940 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.596083 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.586660 | no |
| DIF_cap_tissue | YFB_veil | 0.685073 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|115830 MPGPRVYTHWWGDKHGAVKQKGITQYAISPWQTKAAPHMFRNYLFNGYRRISSELIFWVLPFGIGYGIYTWGKSR YDWQNTKAGHLAESAE* |
| Coding | >AgabiH97|115830 ATGCCCGGTCCTAGGGTCTATACCCATTGGTGGGGCGACAAGCATGGCGCTGTAAAGCAAAAGGGTATTACCCAA TACGCCATCTCTCCCTGGCAGACGAAGGCCGCTCCTCACATGTTCCGTAATTACCTTTTCAACGGCTATCGTCGC ATTTCTAGCGAACTCATCTTCTGGGTCCTTCCTTTCGGTATTGGATATGGGATCTATACTTGGGGCAAGAGTCGT TACGACTGGCAAAATACCAAGGCTGGACACTTGGCTGAAAGTGCAGAATAA |
| Transcript | >AgabiH97|115830 ATGCCCGGTCCTAGGGTCTATACCCATTGGTGGGGCGACAAGCATGGCGCTGTAAAGCAAAAGGGTATTACCCAA TACGCCATCTCTCCCTGGCAGACGAAGGCCGCTCCTCACATGTTCCGTAATTACCTTTTCAACGGCTATCGTCGC ATTTCTAGCGAACTCATCTTCTGGGTCCTTCCTTTCGGTATTGGATATGGGATCTATACTTGGGGCAAGAGTCGT TACGACTGGCAAAATACCAAGGCTGGACACTTGGCTGAAAGTGCAGAATAA |
| Gene | >AgabiH97|115830 ATGCCCGGTCGTGAGTGTCTCTATGTTCGTTGGAAAAATAACTTGGAATAATTTTACTTCAACAGCTAGGGTCTA TGTAAGGCCGCAGAATACATCAGAACGCAAGCTACTCACTTCACCTTATTCATAGACCCATTGGTGGGGCGACAA GCATGGCGCTGTAAAGCAAAAGGGTATTACCCAATACGGCACGTTCTCATGTCTCTTCATACGTTTCCATACTGA CGATTCTAATTAGCCATCTCTCCCTGGCAGACGAAGGCCGCTCCTCACATGTTCCGTAATTACCTTTTCAACGGC TATCGTCGCATTTCTAGCGAACTCATCTTCTGGGTCCTTCCTTTCGGTATTGGTGCGTTACTGTCAATTCCCTGT CCCACCGCCATGATTCGGTTAATGACCAAACTCTGGCGATAGGATATGGGATCTATACTTGGGGCAAGAGTCGTT ACGACTGGCAAAATACCAAGGCTGGACACTTGGCTGAAAGTGCAGAATAA |