Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115830
Gene name
Locationscaffold_9:573380..573880
Strand-
Gene length (bp)500
Transcript length (bp)276
Coding sequence length (bp)276
Protein length (aa) 92

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02939 UcrQ UcrQ family 1.8E-28 10 85

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P50523|QCR8_SCHPO Cytochrome b-c1 complex subunit 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr8 PE=3 SV=1 3 89 1.0E-15
sp|P08525|QCR8_YEAST Cytochrome b-c1 complex subunit 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR8 PE=1 SV=2 2 64 4.0E-10
sp|P49346|QCR8_KLULA Cytochrome b-c1 complex subunit 8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR8 PE=3 SV=1 2 64 3.0E-09
sp|P48503|QCR8_NEUCR Cytochrome b-c1 complex subunit 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-8 PE=1 SV=1 7 84 6.0E-09
sp|O14949|QCR8_HUMAN Cytochrome b-c1 complex subunit 8 OS=Homo sapiens GN=UQCRQ PE=1 SV=4 19 82 8.0E-06

GO

GO Term Description Terminal node
GO:0005750 mitochondrial respiratory chain complex III Yes
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c Yes
GO:0008152 metabolic process No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0019646 aerobic electron transport chain No
GO:0005575 cellular_component No
GO:0098798 mitochondrial protein-containing complex No
GO:0006091 generation of precursor metabolites and energy No
GO:0098803 respiratory chain complex No
GO:0009060 aerobic respiration No
GO:0045275 respiratory chain complex III No
GO:0008150 biological_process No
GO:0098796 membrane protein complex No
GO:0022900 electron transport chain No
GO:1902495 transmembrane transporter complex No
GO:1902494 catalytic complex No
GO:0022904 respiratory electron transport chain No
GO:1990351 transporter complex No
GO:0045333 cellular respiration No
GO:0032991 protein-containing complex No
GO:0070069 cytochrome complex No
GO:0009987 cellular process No
GO:0015980 energy derivation by oxidation of organic compounds No
GO:1990204 oxidoreductase complex No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 55 72 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115830
MPGPRVYTHWWGDKHGAVKQKGITQYAISPWQTKAAPHMFRNYLFNGYRRISSELIFWVLPFGIGYGIYTWGKSR
YDWQNTKAGHLAESAE*
Coding >AgabiH97|115830
ATGCCCGGTCCTAGGGTCTATACCCATTGGTGGGGCGACAAGCATGGCGCTGTAAAGCAAAAGGGTATTACCCAA
TACGCCATCTCTCCCTGGCAGACGAAGGCCGCTCCTCACATGTTCCGTAATTACCTTTTCAACGGCTATCGTCGC
ATTTCTAGCGAACTCATCTTCTGGGTCCTTCCTTTCGGTATTGGATATGGGATCTATACTTGGGGCAAGAGTCGT
TACGACTGGCAAAATACCAAGGCTGGACACTTGGCTGAAAGTGCAGAATAA
Transcript >AgabiH97|115830
ATGCCCGGTCCTAGGGTCTATACCCATTGGTGGGGCGACAAGCATGGCGCTGTAAAGCAAAAGGGTATTACCCAA
TACGCCATCTCTCCCTGGCAGACGAAGGCCGCTCCTCACATGTTCCGTAATTACCTTTTCAACGGCTATCGTCGC
ATTTCTAGCGAACTCATCTTCTGGGTCCTTCCTTTCGGTATTGGATATGGGATCTATACTTGGGGCAAGAGTCGT
TACGACTGGCAAAATACCAAGGCTGGACACTTGGCTGAAAGTGCAGAATAA
Gene >AgabiH97|115830
ATGCCCGGTCGTGAGTGTCTCTATGTTCGTTGGAAAAATAACTTGGAATAATTTTACTTCAACAGCTAGGGTCTA
TGTAAGGCCGCAGAATACATCAGAACGCAAGCTACTCACTTCACCTTATTCATAGACCCATTGGTGGGGCGACAA
GCATGGCGCTGTAAAGCAAAAGGGTATTACCCAATACGGCACGTTCTCATGTCTCTTCATACGTTTCCATACTGA
CGATTCTAATTAGCCATCTCTCCCTGGCAGACGAAGGCCGCTCCTCACATGTTCCGTAATTACCTTTTCAACGGC
TATCGTCGCATTTCTAGCGAACTCATCTTCTGGGTCCTTCCTTTCGGTATTGGTGCGTTACTGTCAATTCCCTGT
CCCACCGCCATGATTCGGTTAATGACCAAACTCTGGCGATAGGATATGGGATCTATACTTGGGGCAAGAGTCGTT
ACGACTGGCAAAATACCAAGGCTGGACACTTGGCTGAAAGTGCAGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail