Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115750
Gene name
Locationscaffold_9:548893..549828
Strand+
Gene length (bp)935
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16015 Promethin Promethin 4.8E-16 22 125

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q922Z1|TM159_MOUSE Promethin OS=Mus musculus GN=Tmem159 PE=2 SV=1 39 161 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 71 93 22
3 95 117 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115750
MSDRKATRYFDKSTSLVRDTFSQFEQQYARPAYSNMHVYFRERPITSTFVTIFTLLSLIPVAFFAGIASFIFATF
TLAALFLAVAASSIVILACFAFLLCVLIGAFLLSLFLTGAVLSSYALVRLAHHVQREGPSAGVSEWKKETKSAFL
RSRPTTQDAADQGKKEPVLTIKPKDEYENEDGDQEGLPASLYEVDDQSDMTLRKEDEEDEEDVKGKGNMDARDFA
TDIKDEEDGEMRRAHQ*
Coding >AgabiH97|115750
ATGTCTGACAGGAAAGCGACCCGGTACTTCGATAAGAGCACTTCCCTCGTTCGCGACACATTCTCTCAGTTCGAG
CAGCAATATGCGCGGCCAGCATACAGTAATATGCATGTGTATTTCAGAGAACGTCCTATAACCTCAACATTTGTG
ACTATATTCACCCTCCTCAGCTTGATCCCCGTTGCCTTCTTTGCGGGCATCGCTTCATTCATCTTTGCTACCTTT
ACTCTCGCAGCACTTTTCCTTGCCGTTGCAGCCTCGTCCATCGTGATCCTAGCTTGCTTCGCTTTTCTGTTATGC
GTTTTAATCGGCGCCTTCTTACTCTCTCTCTTCCTCACCGGTGCGGTGCTCTCATCCTATGCCCTCGTCCGTCTC
GCCCACCACGTCCAACGCGAGGGTCCTTCTGCAGGCGTCTCAGAATGGAAGAAAGAAACAAAATCCGCCTTTTTG
CGTTCACGTCCGACGACCCAAGACGCAGCAGACCAAGGCAAAAAGGAGCCTGTTTTGACTATAAAACCTAAAGAT
GAATACGAAAATGAGGACGGTGATCAAGAAGGGTTGCCGGCTAGCCTGTATGAGGTCGATGATCAGAGTGATATG
ACGCTCAGAAAGGAGGATGAAGAGGACGAAGAGGATGTCAAAGGAAAAGGAAACATGGATGCGCGTGATTTTGCG
ACTGATATCAAGGATGAAGAAGATGGTGAGATGCGACGGGCTCATCAATAA
Transcript >AgabiH97|115750
ATGTCTGACAGGAAAGCGACCCGGTACTTCGATAAGAGCACTTCCCTCGTTCGCGACACATTCTCTCAGTTCGAG
CAGCAATATGCGCGGCCAGCATACAGTAATATGCATGTGTATTTCAGAGAACGTCCTATAACCTCAACATTTGTG
ACTATATTCACCCTCCTCAGCTTGATCCCCGTTGCCTTCTTTGCGGGCATCGCTTCATTCATCTTTGCTACCTTT
ACTCTCGCAGCACTTTTCCTTGCCGTTGCAGCCTCGTCCATCGTGATCCTAGCTTGCTTCGCTTTTCTGTTATGC
GTTTTAATCGGCGCCTTCTTACTCTCTCTCTTCCTCACCGGTGCGGTGCTCTCATCCTATGCCCTCGTCCGTCTC
GCCCACCACGTCCAACGCGAGGGTCCTTCTGCAGGCGTCTCAGAATGGAAGAAAGAAACAAAATCCGCCTTTTTG
CGTTCACGTCCGACGACCCAAGACGCAGCAGACCAAGGCAAAAAGGAGCCTGTTTTGACTATAAAACCTAAAGAT
GAATACGAAAATGAGGACGGTGATCAAGAAGGGTTGCCGGCTAGCCTGTATGAGGTCGATGATCAGAGTGATATG
ACGCTCAGAAAGGAGGATGAAGAGGACGAAGAGGATGTCAAAGGAAAAGGAAACATGGATGCGCGTGATTTTGCG
ACTGATATCAAGGATGAAGAAGATGGTGAGATGCGACGGGCTCATCAATAA
Gene >AgabiH97|115750
ATGTCTGACAGGAAAGCGACCCGGTACTTCGATAAGAGCACTTCCCTCGTTCGCGACACATTCTCTCAGTGAGCG
TTATGCTTTTCTTCGAACAGCAAGTATTCAGCAGTCACTAGGTTCGAGCAGCAATATGCGCGGCCAGCATACAGT
AATATGCATGTGTATTTCAGAGAACGTCCTATAACCTCAGTGAGCGCCGTTGTTTTTCGTTTCGGAAAGGAAAAA
ATCTTGATGCTTCCTTCAGACATTTGTGACTATATTCACCCTCCTCAGCTTGATCCCCGTTGCCTTCTTTGCGTA
CGAGTATCTCTCTCACCGCATATCAAGTTGCACGCTCATGCCTCGTTTAGGGGCATCGCTTCATTCATCTTTGCT
ACCTTTACTCTCGCAGCACTTTTCCTTGCCGTTGCAGCCTCGTCCATCGTGATCCTAGCTTGCTGTAAGTTATCC
TTTACATTCAATGTGTCTCCTTGCCTCATCCCGGTCGCCCAGTCGCTTTTCTGTTATGCGTTTTAATCGGCGCCT
TCTTACTCTCTCTCTTCCTCACCGGTGCGGTGCTCTCATCCTATGCCCTCGTCCGTCTCGCCCACCACGTCCAAC
GCGAGGGTCCTTCTGCAGGCGTCTCAGAATGGAAGAAAGAAACAAAATCCGCCTTTTTGCGTTCACGTCCGACGA
CCCAAGACGCAGCAGACCAAGGCAAAAAGGAGCCTGTTTTGACTATAAAACCTAAAGATGAATACGAAAATGAGG
ACGGTGATCAAGAAGGGTTGCCGGCTAGCCTGTATGAGGTCGATGATCAGAGTGATATGACGCTCAGAAAGGAGG
ATGAAGAGGACGAAGAGGATGTCAAAGGAAAAGGAAACATGGATGCGCGTGATTTTGCGACTGATATCAAGGATG
AAGAAGATGGTGAGATGCGACGGGCTCATCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail