© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|115700 |
| Gene name | |
| Location | scaffold_9:538444..539414 |
| Strand | - |
| Gene length (bp) | 970 |
| Transcript length (bp) | 732 |
| Coding sequence length (bp) | 732 |
| Protein length (aa) | 244 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00734 | CBM_1 | Fungal cellulose binding domain | 1.2E-12 | 25 | 53 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A1C8U0|MANF_ASPCL | Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 | 5 | 92 | 9.0E-13 |
| sp|P07982|GUN2_HYPJE | Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 | 7 | 67 | 3.0E-12 |
| sp|Q9HEZ1|XYNA_PHACH | Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 | 26 | 127 | 5.0E-11 |
| sp|I1S3C6|XYND_GIBZE | Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 | 2 | 74 | 1.0E-10 |
| sp|Q4WM08|CBHB_ASPFU | Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 | 25 | 57 | 2.0E-10 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A1C8U0|MANF_ASPCL | Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 | 5 | 92 | 9.0E-13 |
| sp|P07982|GUN2_HYPJE | Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 | 7 | 67 | 3.0E-12 |
| sp|Q9HEZ1|XYNA_PHACH | Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 | 26 | 127 | 5.0E-11 |
| sp|I1S3C6|XYND_GIBZE | Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 | 2 | 74 | 1.0E-10 |
| sp|Q4WM08|CBHB_ASPFU | Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 | 25 | 57 | 2.0E-10 |
| sp|B0Y8K2|CBHB_ASPFC | Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 | 25 | 57 | 2.0E-10 |
| sp|P62695|GUX1_TRIKO | Exoglucanase 1 OS=Trichoderma koningii GN=cbh1 PE=3 SV=1 | 22 | 57 | 5.0E-10 |
| sp|P62694|GUX1_HYPJE | Exoglucanase 1 OS=Hypocrea jecorina GN=cbh1 PE=1 SV=1 | 22 | 57 | 5.0E-10 |
| sp|B7SIW2|XYNC_PHACH | Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 | 25 | 72 | 8.0E-10 |
| sp|P19355|GUX1_HYPRU | Exoglucanase 1 OS=Hypocrea rufa GN=cbh1 PE=3 SV=2 | 22 | 57 | 1.0E-09 |
| sp|P79046|XYN1_HUMGT | Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 | 23 | 57 | 1.0E-09 |
| sp|Q9P8P3|GUX1_TRIHA | Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 | 22 | 57 | 2.0E-09 |
| sp|P46239|GUNF_FUSOX | Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 | 10 | 69 | 2.0E-09 |
| sp|B8NIV9|MANF_ASPFN | Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=manF PE=3 SV=1 | 5 | 60 | 4.0E-09 |
| sp|Q2U2I3|MANF_ASPOR | Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=manF PE=3 SV=2 | 5 | 60 | 4.0E-09 |
| sp|B0XWL3|CBHC_ASPFC | Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 | 2 | 59 | 5.0E-09 |
| sp|Q4WFK4|CBHC_ASPFU | Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 | 2 | 59 | 5.0E-09 |
| sp|A1DJQ7|CBHC_NEOFI | Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 | 2 | 59 | 7.0E-09 |
| sp|A1DNL0|CBHB_NEOFI | Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhB PE=3 SV=1 | 25 | 57 | 7.0E-09 |
| sp|Q7SDR1|GUN3_NEUCR | Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 | 14 | 84 | 7.0E-09 |
| sp|Q9C1S9|GUX6_HUMIN | Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 | 26 | 60 | 9.0E-09 |
| sp|Q5ZNB1|XYND_TALFU | Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 | 25 | 57 | 1.0E-08 |
| sp|G2Q9T3|CEL61_MYCTT | Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 | 19 | 57 | 1.0E-08 |
| sp|P07987|GUX2_HYPJE | Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 | 24 | 126 | 2.0E-08 |
| sp|P46236|GUNB_FUSOX | Putative endoglucanase type B OS=Fusarium oxysporum PE=2 SV=1 | 26 | 120 | 2.0E-08 |
| sp|P49075|GUX3_AGABI | Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 | 26 | 60 | 4.0E-08 |
| sp|A8PB24|AXE1_COPC7 | Acetylxylan esterase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_12850 PE=1 SV=1 | 1 | 61 | 7.0E-08 |
| sp|G0RV93|CIP2_HYPJQ | 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 | 11 | 58 | 8.0E-08 |
| sp|Q7SA23|GUX1A_NEUCR | Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 | 24 | 57 | 1.0E-07 |
| sp|Q0CMT2|CBHB_ASPTN | Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 | 25 | 57 | 1.0E-07 |
| sp|A1DBV1|MANF_NEOFI | Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manF PE=3 SV=1 | 8 | 70 | 2.0E-07 |
| sp|G2QCS4|CEL7A_MYCTT | Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=eg7A PE=1 SV=1 | 22 | 57 | 2.0E-07 |
| sp|Q5B2E8|CBHC_EMENI | 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 | 10 | 60 | 4.0E-07 |
| sp|Q0CFP1|CBHC_ASPTN | Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 | 23 | 58 | 4.0E-07 |
| sp|Q7Z9M8|XG74_HYPJQ | Xyloglucanase OS=Hypocrea jecorina (strain QM6a) GN=cel74a PE=1 SV=1 | 25 | 57 | 4.0E-07 |
| sp|Q5AR04|MANF_EMENI | Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 | 14 | 59 | 4.0E-07 |
| sp|O59843|CBHB_ASPAC | 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus aculeatus GN=cbhB PE=2 SV=1 | 26 | 57 | 4.0E-07 |
| sp|Q9HE18|FAEB_TALFU | Feruloyl esterase B OS=Talaromyces funiculosus GN=FAEB PE=1 SV=1 | 22 | 57 | 5.0E-07 |
| sp|Q99034|AXE1_HYPJE | Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 | 22 | 57 | 5.0E-07 |
| sp|Q4WBW4|AXE1_ASPFU | Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 | 25 | 57 | 7.0E-07 |
| sp|P50272|PSBP_PORPU | Putative polysaccharide-binding protein OS=Porphyra purpurea PE=2 SV=1 | 26 | 75 | 8.0E-07 |
| sp|A2QAI7|CBHB_ASPNC | Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhB PE=3 SV=1 | 26 | 57 | 9.0E-07 |
| sp|Q9UVS8|CBHB_ASPNG | 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger GN=cbhB PE=2 SV=1 | 26 | 57 | 9.0E-07 |
| sp|A1DBP9|AXE1_NEOFI | Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 | 24 | 57 | 1.0E-06 |
| sp|A1CCN4|CBHC_ASPCL | Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhC PE=3 SV=1 | 23 | 59 | 1.0E-06 |
| sp|Q8NJ73|XYN6_MAGGR | Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 | 26 | 60 | 1.0E-06 |
| sp|G4MPQ7|XYN6_MAGO7 | Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 | 26 | 60 | 1.0E-06 |
| sp|Q4WBS1|MANF_ASPFU | Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 | 10 | 58 | 2.0E-06 |
| sp|B0Y9E7|MANF_ASPFC | Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 | 10 | 58 | 2.0E-06 |
| sp|Q12624|GUN3_HUMIN | Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 | 7 | 58 | 2.0E-06 |
| sp|Q8NJP6|AXE1_TALPU | Acetylxylan esterase A OS=Talaromyces purpurogenus GN=axeA PE=1 SV=1 | 24 | 57 | 2.0E-06 |
| sp|Q8J0K5|XYNB_TALFU | Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 | 24 | 56 | 3.0E-06 |
| sp|Q92400|GUX2_AGABI | Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 | 23 | 57 | 5.0E-06 |
| sp|Q8WZJ4|XYNA_TALFU | 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 | 24 | 57 | 5.0E-06 |
| sp|O14405|GUN4_HYPJE | Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 | 18 | 57 | 6.0E-06 |
| sp|P46238|GUXC_FUSOX | Putative exoglucanase type C OS=Fusarium oxysporum PE=2 SV=1 | 20 | 56 | 6.0E-06 |
| sp|A1CU44|CBHB_ASPCL | Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhB PE=3 SV=1 | 26 | 57 | 6.0E-06 |
| sp|A2QYR9|CBHC_ASPNC | Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 | 7 | 60 | 6.0E-06 |
| sp|P07981|GUN1_HYPJE | Endoglucanase EG-1 OS=Hypocrea jecorina GN=egl1 PE=1 SV=1 | 25 | 57 | 7.0E-06 |
| sp|B2ABX7|CEL6A_PODAN | 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 | 24 | 64 | 7.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005576 | extracellular region | Yes |
| GO:0005975 | carbohydrate metabolic process | Yes |
| GO:0030248 | cellulose binding | Yes |
| GO:0008152 | metabolic process | No |
| GO:0005575 | cellular_component | No |
| GO:0003674 | molecular_function | No |
| GO:0005488 | binding | No |
| GO:0030247 | polysaccharide binding | No |
| GO:0008150 | biological_process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0110165 | cellular anatomical entity | No |
| GO:0044238 | primary metabolic process | No |
| GO:0030246 | carbohydrate binding | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Extracellular | Signal peptide | 0.1084 | 0.0796 | 0.9672 | 0.0784 | 0.0682 | 0.0066 | 0.1206 | 0.1688 | 0.1788 | 0.0039 |
| SignalP signal predicted | Location | Score |
|---|---|---|
| Yes | 1 - 20 | 0.999726 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 46.78 | 22.62 | 70.93 |
| Initials | Initials knots | 30.80 | 15.88 | 45.72 |
| Pileal_Stipeal_center | Stage I stipe center | 15.46 | 7.25 | 23.66 |
| Pileal_Stipeal_shell | Stage I stipe shell | 12.04 | 5.39 | 18.69 |
| DIF_stipe_center | Stage II stipe center | 14.20 | 6.55 | 21.84 |
| DIF_stipe_shell | Stage II stipe shell | 17.28 | 8.24 | 26.32 |
| DIF_stipe_skin | Stage II stipe skin | 18.30 | 8.81 | 27.80 |
| DIF_cap_skin | Stage II cap skin | 10.50 | 4.66 | 16.34 |
| DIF_cap_tissue | Stage II cap tissue | 10.10 | 4.37 | 15.84 |
| DIF_gill_tissue | Stage II gill tissue | 10.69 | 4.75 | 16.64 |
| YFB_stipe_center | Young fruiting body stipe center | 19.34 | 9.34 | 29.33 |
| YFB_stipe_shell | Young fruiting body stipe shell | 19.88 | 9.57 | 30.19 |
| YFB_stipe_skin | Young fruiting body stipe skin | 16.16 | 7.59 | 24.74 |
| YFB_cap_skin | Young fruiting body cap skin | 13.78 | 6.32 | 21.24 |
| YFB_cap_tissue | Young fruiting body cap tissue | 14.76 | 6.83 | 22.69 |
| YFB_gill_tissue | Young fruiting body gill tissue | 12.72 | 5.75 | 19.68 |
| YFB_veil | Young fruiting body veil | 13.09 | 5.97 | 20.22 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.000613 | yes |
| Casing | YFB_stipe_center | 0.007782 | yes |
| Casing | YFB_stipe_shell | 0.010093 | yes |
| Casing | YFB_stipe_skin | 0.000613 | yes |
| Casing | YFB_cap_skin | 0.000613 | yes |
| Casing | YFB_cap_tissue | 0.002084 | yes |
| Casing | YFB_gill_tissue | 0.000613 | yes |
| Casing | YFB_veil | 0.000613 | yes |
| Casing | Initials | 0.282797 | no |
| Casing | Pileal_Stipeal_center | 0.000613 | yes |
| Casing | Pileal_Stipeal_shell | 0.000613 | yes |
| Casing | DIF_stipe_center | 0.000613 | yes |
| Casing | DIF_stipe_shell | 0.001140 | yes |
| Casing | DIF_stipe_skin | 0.004928 | yes |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.114735 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.091330 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.319789 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.620988 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.495089 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.768928 | no |
| DIF_gill_tissue | YFB_veil | 0.713197 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.969329 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.743644 | no |
| YFB_stipe_center | YFB_cap_skin | 0.458582 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.584765 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.319503 | no |
| YFB_stipe_center | YFB_veil | 0.367998 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.686418 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.403840 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.524695 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.275834 | no |
| YFB_stipe_shell | YFB_veil | 0.319333 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.790147 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.892303 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.643378 | no |
| YFB_stipe_skin | YFB_veil | 0.692158 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.923706 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.910676 | no |
| YFB_cap_skin | YFB_veil | 0.942780 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.809985 | no |
| YFB_cap_tissue | YFB_veil | 0.850448 | no |
| YFB_gill_tissue | YFB_veil | 0.967560 | no |
| Initials | DIF_gill_tissue | 0.000613 | yes |
| Initials | YFB_stipe_center | 0.218082 | no |
| Initials | YFB_stipe_shell | 0.250159 | no |
| Initials | YFB_stipe_skin | 0.061086 | no |
| Initials | YFB_cap_skin | 0.018896 | yes |
| Initials | YFB_cap_tissue | 0.038495 | yes |
| Initials | YFB_gill_tissue | 0.008791 | yes |
| Initials | YFB_veil | 0.009773 | yes |
| Initials | Pileal_Stipeal_center | 0.040279 | yes |
| Initials | Pileal_Stipeal_shell | 0.005302 | yes |
| Initials | DIF_stipe_center | 0.023676 | yes |
| Initials | DIF_stipe_shell | 0.095962 | no |
| Initials | DIF_stipe_skin | 0.150303 | no |
| Initials | DIF_cap_skin | 0.001140 | yes |
| Initials | DIF_cap_tissue | 0.001625 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.390333 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.657798 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.602347 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.948268 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.857734 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.948347 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.728626 | no |
| Pileal_Stipeal_center | YFB_veil | 0.772688 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.616889 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.899698 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.857647 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.762381 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.365965 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.322151 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.857025 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.237447 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.200439 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.533979 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.831418 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.718803 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.940652 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.901721 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.781730 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.409844 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.321624 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.826192 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.770979 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.566885 | no |
| DIF_stipe_center | YFB_stipe_center | 0.506520 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.457274 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.829206 | no |
| DIF_stipe_center | YFB_cap_skin | 0.968331 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.957470 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.869919 | no |
| DIF_stipe_center | YFB_veil | 0.906424 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.720132 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.615102 | no |
| DIF_stipe_center | DIF_cap_skin | 0.537055 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.479204 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.225375 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.854547 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.812952 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.920707 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.666275 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.789222 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.517682 | no |
| DIF_stipe_shell | YFB_veil | 0.566485 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.932632 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.209726 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.182435 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.151916 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.937059 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.898478 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.830856 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.551685 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.683882 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.407835 | no |
| DIF_stipe_skin | YFB_veil | 0.457545 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.141808 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.124266 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.980071 | no |
| DIF_cap_skin | YFB_stipe_center | 0.100894 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.080708 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.294241 | no |
| DIF_cap_skin | YFB_cap_skin | 0.593139 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.468272 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.745116 | no |
| DIF_cap_skin | YFB_veil | 0.687290 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.958862 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.942464 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.087080 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.067334 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.258299 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.537117 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.415960 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.686844 | no |
| DIF_cap_tissue | YFB_veil | 0.628106 | no |
| Orthofinder run ID | 1 |
| Orthogroup | 1490 |
| Change Orthofinder run |
| Species | Protein ID |
|---|---|
| Agaricus bisporus var bisporus H39 | AgabiH39|115700 |
| Agaricus bisporus var bisporus H97 | AgabiH97|115700 (this protein) |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|115700 MITYLSLVASVALLVGGASAQTQSQYGQCGGIGWSGPTLCPSGWSCQKLNDYYSQCLPGSATPTPTTTSNPGSPP VTTLPPTTTNNPGATPTLAPGYSFIRAVEDPNFHKYLRSEVSSTASDAVLGEPVDAAQFQITGGQLVQNANGKSL YAIVEAYTGADQKKLQVTWSATPSTSGAFSWSGDTVLWHDPNVPRPQDNAWLVCPDADGNRDLYINLGPYSYQTP AGCADETIHAYTGSTPTD* |
| Coding | >AgabiH97|115700 ATGATCACATACCTTTCCTTAGTCGCTAGTGTTGCACTCCTTGTAGGAGGAGCCTCTGCCCAAACTCAAAGTCAA TATGGTCAGTGTGGTGGCATTGGCTGGAGCGGTCCTACCCTTTGTCCCAGCGGTTGGTCTTGCCAGAAGCTAAAC GACTATTACTCTCAATGTCTCCCTGGATCGGCGACGCCAACACCCACAACTACCTCAAATCCGGGAAGTCCTCCA GTAACCACGCTCCCCCCTACCACCACGAACAATCCGGGTGCAACGCCAACTCTGGCTCCTGGATATTCCTTCATC AGAGCTGTTGAAGATCCTAACTTCCATAAGTATCTCCGTTCAGAAGTTTCCAGTACCGCCTCGGATGCCGTTCTC GGAGAACCTGTAGATGCCGCCCAATTCCAGATCACAGGCGGACAACTTGTCCAAAATGCCAATGGCAAATCTCTT TATGCCATTGTTGAGGCTTACACCGGTGCGGACCAAAAGAAGCTCCAGGTCACTTGGTCTGCTACTCCCTCTACG TCGGGTGCCTTCTCCTGGAGCGGTGATACAGTCCTATGGCACGATCCCAATGTTCCCCGCCCACAAGACAACGCT TGGTTGGTCTGTCCCGATGCCGATGGCAACAGGGATTTGTATATCAACTTGGGTCCTTACTCTTACCAGACCCCG GCTGGCTGCGCCGACGAGACCATTCACGCATATACGGGGTCAACGCCCACTGATTAA |
| Transcript | >AgabiH97|115700 ATGATCACATACCTTTCCTTAGTCGCTAGTGTTGCACTCCTTGTAGGAGGAGCCTCTGCCCAAACTCAAAGTCAA TATGGTCAGTGTGGTGGCATTGGCTGGAGCGGTCCTACCCTTTGTCCCAGCGGTTGGTCTTGCCAGAAGCTAAAC GACTATTACTCTCAATGTCTCCCTGGATCGGCGACGCCAACACCCACAACTACCTCAAATCCGGGAAGTCCTCCA GTAACCACGCTCCCCCCTACCACCACGAACAATCCGGGTGCAACGCCAACTCTGGCTCCTGGATATTCCTTCATC AGAGCTGTTGAAGATCCTAACTTCCATAAGTATCTCCGTTCAGAAGTTTCCAGTACCGCCTCGGATGCCGTTCTC GGAGAACCTGTAGATGCCGCCCAATTCCAGATCACAGGCGGACAACTTGTCCAAAATGCCAATGGCAAATCTCTT TATGCCATTGTTGAGGCTTACACCGGTGCGGACCAAAAGAAGCTCCAGGTCACTTGGTCTGCTACTCCCTCTACG TCGGGTGCCTTCTCCTGGAGCGGTGATACAGTCCTATGGCACGATCCCAATGTTCCCCGCCCACAAGACAACGCT TGGTTGGTCTGTCCCGATGCCGATGGCAACAGGGATTTGTATATCAACTTGGGTCCTTACTCTTACCAGACCCCG GCTGGCTGCGCCGACGAGACCATTCACGCATATACGGGGTCAACGCCCACTGATTAA |
| Gene | >AgabiH97|115700 ATGATCACATACCTTTCCTTAGTCGCTAGTGTTGCACTCCTTGTAGGAGGAGCCTCTGCCCAAACTCAAAGTCAA TATGGTCAGGTCGGTAGCCGGAAACCTCTACTTTGTTATACCTCTTACTCATAACTCATTCGATGGATTGTCGTT CACAGTGTGGTGGCATTGGCTGGAGCGGTCCTACCCTTTGTCCCAGCGGTTGGTCTTGCCAGAAGCTAAACGACT ATTACTCTCAATGTCTCCCTGGATCGGCGACGCCAACACCCACAACTACCTCAAATCCGGGAAGGTGGGATTTGA TTGTTGGAGGATTGAATCTATCTGATCTTTTTAATAGTCCTCCAGTAACCACGCTCCCCCCTACCACCACGAACA ATCCGGGTGCAACGCCAACTCTGGCTCCTGGATATTCCTTCATCAGAGCTGTTGTAAGTCCAACCCACTCCAATG ATCGCTTCATAAGTTATCGTACTCAAATTTCTATAGGAAGATCCTAACTTCCATAAGTATCTCCGTTCAGAAGTT TCCAGTACCGCCTCGGATGCCGTTCTCGGAGAACCTGTAGATGCCGCCCAATTCCAGATCACAGGCGGACAACTT GTCCAAAATGCCAATGGCAAATCTCTTTATGCCATTGTTGAGGCTTACACCGGTGCGGACCAAAAGAAGCTCCAG GTCACTTGGTCTGCTACTCCCTCTACGTCGGGTGCCTTCTCCTGGAGCGGTGATACAGTCCTATGGCACGATCCC AATGTTCCCCGCCCACAAGACAACGTGAGTTCTGCTTTTTGATTCCGGGTTAAGAATTCGATTTATTATTCACTA CTTCGTACAGGCTTGGTTGGTCTGTCCCGATGCCGATGGCAACAGGGATTTGTATATCAACTTGGGTCCTTACTC TTACCAGACCCCGGCTGGCTGCGCCGACGAGACCATTCACGCATATACGGGGTCAACGCCCACTGATTAA |