Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115700
Gene name
Locationscaffold_9:538444..539414
Strand-
Gene length (bp)970
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00734 CBM_1 Fungal cellulose binding domain 1.2E-12 25 53

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 5 92 9.0E-13
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 7 67 3.0E-12
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 26 127 5.0E-11
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 2 74 1.0E-10
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 25 57 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 5 92 9.0E-13
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 7 67 3.0E-12
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 26 127 5.0E-11
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 2 74 1.0E-10
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 25 57 2.0E-10
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 25 57 2.0E-10
sp|P62695|GUX1_TRIKO Exoglucanase 1 OS=Trichoderma koningii GN=cbh1 PE=3 SV=1 22 57 5.0E-10
sp|P62694|GUX1_HYPJE Exoglucanase 1 OS=Hypocrea jecorina GN=cbh1 PE=1 SV=1 22 57 5.0E-10
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 25 72 8.0E-10
sp|P19355|GUX1_HYPRU Exoglucanase 1 OS=Hypocrea rufa GN=cbh1 PE=3 SV=2 22 57 1.0E-09
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 23 57 1.0E-09
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 22 57 2.0E-09
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 10 69 2.0E-09
sp|B8NIV9|MANF_ASPFN Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=manF PE=3 SV=1 5 60 4.0E-09
sp|Q2U2I3|MANF_ASPOR Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=manF PE=3 SV=2 5 60 4.0E-09
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 2 59 5.0E-09
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 2 59 5.0E-09
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 2 59 7.0E-09
sp|A1DNL0|CBHB_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhB PE=3 SV=1 25 57 7.0E-09
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 14 84 7.0E-09
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 26 60 9.0E-09
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 25 57 1.0E-08
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 19 57 1.0E-08
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 24 126 2.0E-08
sp|P46236|GUNB_FUSOX Putative endoglucanase type B OS=Fusarium oxysporum PE=2 SV=1 26 120 2.0E-08
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 26 60 4.0E-08
sp|A8PB24|AXE1_COPC7 Acetylxylan esterase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_12850 PE=1 SV=1 1 61 7.0E-08
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 11 58 8.0E-08
sp|Q7SA23|GUX1A_NEUCR Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbh-1 PE=3 SV=1 24 57 1.0E-07
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 25 57 1.0E-07
sp|A1DBV1|MANF_NEOFI Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manF PE=3 SV=1 8 70 2.0E-07
sp|G2QCS4|CEL7A_MYCTT Endoglucanase 7a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=eg7A PE=1 SV=1 22 57 2.0E-07
sp|Q5B2E8|CBHC_EMENI 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 10 60 4.0E-07
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 23 58 4.0E-07
sp|Q7Z9M8|XG74_HYPJQ Xyloglucanase OS=Hypocrea jecorina (strain QM6a) GN=cel74a PE=1 SV=1 25 57 4.0E-07
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 14 59 4.0E-07
sp|O59843|CBHB_ASPAC 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus aculeatus GN=cbhB PE=2 SV=1 26 57 4.0E-07
sp|Q9HE18|FAEB_TALFU Feruloyl esterase B OS=Talaromyces funiculosus GN=FAEB PE=1 SV=1 22 57 5.0E-07
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 22 57 5.0E-07
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 25 57 7.0E-07
sp|P50272|PSBP_PORPU Putative polysaccharide-binding protein OS=Porphyra purpurea PE=2 SV=1 26 75 8.0E-07
sp|A2QAI7|CBHB_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhB PE=3 SV=1 26 57 9.0E-07
sp|Q9UVS8|CBHB_ASPNG 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger GN=cbhB PE=2 SV=1 26 57 9.0E-07
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 24 57 1.0E-06
sp|A1CCN4|CBHC_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhC PE=3 SV=1 23 59 1.0E-06
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 26 60 1.0E-06
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 26 60 1.0E-06
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 10 58 2.0E-06
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 10 58 2.0E-06
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 7 58 2.0E-06
sp|Q8NJP6|AXE1_TALPU Acetylxylan esterase A OS=Talaromyces purpurogenus GN=axeA PE=1 SV=1 24 57 2.0E-06
sp|Q8J0K5|XYNB_TALFU Endo-1,4-beta-xylanase B OS=Talaromyces funiculosus GN=xynB PE=1 SV=1 24 56 3.0E-06
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 23 57 5.0E-06
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 24 57 5.0E-06
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 18 57 6.0E-06
sp|P46238|GUXC_FUSOX Putative exoglucanase type C OS=Fusarium oxysporum PE=2 SV=1 20 56 6.0E-06
sp|A1CU44|CBHB_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhB PE=3 SV=1 26 57 6.0E-06
sp|A2QYR9|CBHC_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 7 60 6.0E-06
sp|P07981|GUN1_HYPJE Endoglucanase EG-1 OS=Hypocrea jecorina GN=egl1 PE=1 SV=1 25 57 7.0E-06
sp|B2ABX7|CEL6A_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 24 64 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030248 cellulose binding Yes
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0030247 polysaccharide binding No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0044238 primary metabolic process No
GO:0030246 carbohydrate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 46.78 22.62 70.93
Initials Initials knots 30.80 15.88 45.72
Pileal_Stipeal_center Stage I stipe center 15.46 7.25 23.66
Pileal_Stipeal_shell Stage I stipe shell 12.04 5.39 18.69
DIF_stipe_center Stage II stipe center 14.20 6.55 21.84
DIF_stipe_shell Stage II stipe shell 17.28 8.24 26.32
DIF_stipe_skin Stage II stipe skin 18.30 8.81 27.80
DIF_cap_skin Stage II cap skin 10.50 4.66 16.34
DIF_cap_tissue Stage II cap tissue 10.10 4.37 15.84
DIF_gill_tissue Stage II gill tissue 10.69 4.75 16.64
YFB_stipe_center Young fruiting body stipe center 19.34 9.34 29.33
YFB_stipe_shell Young fruiting body stipe shell 19.88 9.57 30.19
YFB_stipe_skin Young fruiting body stipe skin 16.16 7.59 24.74
YFB_cap_skin Young fruiting body cap skin 13.78 6.32 21.24
YFB_cap_tissue Young fruiting body cap tissue 14.76 6.83 22.69
YFB_gill_tissue Young fruiting body gill tissue 12.72 5.75 19.68
YFB_veil Young fruiting body veil 13.09 5.97 20.22

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.007782 yes
Casing YFB_stipe_shell 0.010093 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.002084 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.282797 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.001140 yes
Casing DIF_stipe_skin 0.004928 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.114735 no
DIF_gill_tissue YFB_stipe_shell 0.091330 no
DIF_gill_tissue YFB_stipe_skin 0.319789 no
DIF_gill_tissue YFB_cap_skin 0.620988 no
DIF_gill_tissue YFB_cap_tissue 0.495089 no
DIF_gill_tissue YFB_gill_tissue 0.768928 no
DIF_gill_tissue YFB_veil 0.713197 no
YFB_stipe_center YFB_stipe_shell 0.969329 no
YFB_stipe_center YFB_stipe_skin 0.743644 no
YFB_stipe_center YFB_cap_skin 0.458582 no
YFB_stipe_center YFB_cap_tissue 0.584765 no
YFB_stipe_center YFB_gill_tissue 0.319503 no
YFB_stipe_center YFB_veil 0.367998 no
YFB_stipe_shell YFB_stipe_skin 0.686418 no
YFB_stipe_shell YFB_cap_skin 0.403840 no
YFB_stipe_shell YFB_cap_tissue 0.524695 no
YFB_stipe_shell YFB_gill_tissue 0.275834 no
YFB_stipe_shell YFB_veil 0.319333 no
YFB_stipe_skin YFB_cap_skin 0.790147 no
YFB_stipe_skin YFB_cap_tissue 0.892303 no
YFB_stipe_skin YFB_gill_tissue 0.643378 no
YFB_stipe_skin YFB_veil 0.692158 no
YFB_cap_skin YFB_cap_tissue 0.923706 no
YFB_cap_skin YFB_gill_tissue 0.910676 no
YFB_cap_skin YFB_veil 0.942780 no
YFB_cap_tissue YFB_gill_tissue 0.809985 no
YFB_cap_tissue YFB_veil 0.850448 no
YFB_gill_tissue YFB_veil 0.967560 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.218082 no
Initials YFB_stipe_shell 0.250159 no
Initials YFB_stipe_skin 0.061086 no
Initials YFB_cap_skin 0.018896 yes
Initials YFB_cap_tissue 0.038495 yes
Initials YFB_gill_tissue 0.008791 yes
Initials YFB_veil 0.009773 yes
Initials Pileal_Stipeal_center 0.040279 yes
Initials Pileal_Stipeal_shell 0.005302 yes
Initials DIF_stipe_center 0.023676 yes
Initials DIF_stipe_shell 0.095962 no
Initials DIF_stipe_skin 0.150303 no
Initials DIF_cap_skin 0.001140 yes
Initials DIF_cap_tissue 0.001625 yes
Pileal_Stipeal_center DIF_gill_tissue 0.390333 no
Pileal_Stipeal_center YFB_stipe_center 0.657798 no
Pileal_Stipeal_center YFB_stipe_shell 0.602347 no
Pileal_Stipeal_center YFB_stipe_skin 0.948268 no
Pileal_Stipeal_center YFB_cap_skin 0.857734 no
Pileal_Stipeal_center YFB_cap_tissue 0.948347 no
Pileal_Stipeal_center YFB_gill_tissue 0.728626 no
Pileal_Stipeal_center YFB_veil 0.772688 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.616889 no
Pileal_Stipeal_center DIF_stipe_center 0.899698 no
Pileal_Stipeal_center DIF_stipe_shell 0.857647 no
Pileal_Stipeal_center DIF_stipe_skin 0.762381 no
Pileal_Stipeal_center DIF_cap_skin 0.365965 no
Pileal_Stipeal_center DIF_cap_tissue 0.322151 no
Pileal_Stipeal_shell DIF_gill_tissue 0.857025 no
Pileal_Stipeal_shell YFB_stipe_center 0.237447 no
Pileal_Stipeal_shell YFB_stipe_shell 0.200439 no
Pileal_Stipeal_shell YFB_stipe_skin 0.533979 no
Pileal_Stipeal_shell YFB_cap_skin 0.831418 no
Pileal_Stipeal_shell YFB_cap_tissue 0.718803 no
Pileal_Stipeal_shell YFB_gill_tissue 0.940652 no
Pileal_Stipeal_shell YFB_veil 0.901721 no
Pileal_Stipeal_shell DIF_stipe_center 0.781730 no
Pileal_Stipeal_shell DIF_stipe_shell 0.409844 no
Pileal_Stipeal_shell DIF_stipe_skin 0.321624 no
Pileal_Stipeal_shell DIF_cap_skin 0.826192 no
Pileal_Stipeal_shell DIF_cap_tissue 0.770979 no
DIF_stipe_center DIF_gill_tissue 0.566885 no
DIF_stipe_center YFB_stipe_center 0.506520 no
DIF_stipe_center YFB_stipe_shell 0.457274 no
DIF_stipe_center YFB_stipe_skin 0.829206 no
DIF_stipe_center YFB_cap_skin 0.968331 no
DIF_stipe_center YFB_cap_tissue 0.957470 no
DIF_stipe_center YFB_gill_tissue 0.869919 no
DIF_stipe_center YFB_veil 0.906424 no
DIF_stipe_center DIF_stipe_shell 0.720132 no
DIF_stipe_center DIF_stipe_skin 0.615102 no
DIF_stipe_center DIF_cap_skin 0.537055 no
DIF_stipe_center DIF_cap_tissue 0.479204 no
DIF_stipe_shell DIF_gill_tissue 0.225375 no
DIF_stipe_shell YFB_stipe_center 0.854547 no
DIF_stipe_shell YFB_stipe_shell 0.812952 no
DIF_stipe_shell YFB_stipe_skin 0.920707 no
DIF_stipe_shell YFB_cap_skin 0.666275 no
DIF_stipe_shell YFB_cap_tissue 0.789222 no
DIF_stipe_shell YFB_gill_tissue 0.517682 no
DIF_stipe_shell YFB_veil 0.566485 no
DIF_stipe_shell DIF_stipe_skin 0.932632 no
DIF_stipe_shell DIF_cap_skin 0.209726 no
DIF_stipe_shell DIF_cap_tissue 0.182435 no
DIF_stipe_skin DIF_gill_tissue 0.151916 no
DIF_stipe_skin YFB_stipe_center 0.937059 no
DIF_stipe_skin YFB_stipe_shell 0.898478 no
DIF_stipe_skin YFB_stipe_skin 0.830856 no
DIF_stipe_skin YFB_cap_skin 0.551685 no
DIF_stipe_skin YFB_cap_tissue 0.683882 no
DIF_stipe_skin YFB_gill_tissue 0.407835 no
DIF_stipe_skin YFB_veil 0.457545 no
DIF_stipe_skin DIF_cap_skin 0.141808 no
DIF_stipe_skin DIF_cap_tissue 0.124266 no
DIF_cap_skin DIF_gill_tissue 0.980071 no
DIF_cap_skin YFB_stipe_center 0.100894 no
DIF_cap_skin YFB_stipe_shell 0.080708 no
DIF_cap_skin YFB_stipe_skin 0.294241 no
DIF_cap_skin YFB_cap_skin 0.593139 no
DIF_cap_skin YFB_cap_tissue 0.468272 no
DIF_cap_skin YFB_gill_tissue 0.745116 no
DIF_cap_skin YFB_veil 0.687290 no
DIF_cap_skin DIF_cap_tissue 0.958862 no
DIF_cap_tissue DIF_gill_tissue 0.942464 no
DIF_cap_tissue YFB_stipe_center 0.087080 no
DIF_cap_tissue YFB_stipe_shell 0.067334 no
DIF_cap_tissue YFB_stipe_skin 0.258299 no
DIF_cap_tissue YFB_cap_skin 0.537117 no
DIF_cap_tissue YFB_cap_tissue 0.415960 no
DIF_cap_tissue YFB_gill_tissue 0.686844 no
DIF_cap_tissue YFB_veil 0.628106 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115700
MITYLSLVASVALLVGGASAQTQSQYGQCGGIGWSGPTLCPSGWSCQKLNDYYSQCLPGSATPTPTTTSNPGSPP
VTTLPPTTTNNPGATPTLAPGYSFIRAVEDPNFHKYLRSEVSSTASDAVLGEPVDAAQFQITGGQLVQNANGKSL
YAIVEAYTGADQKKLQVTWSATPSTSGAFSWSGDTVLWHDPNVPRPQDNAWLVCPDADGNRDLYINLGPYSYQTP
AGCADETIHAYTGSTPTD*
Coding >AgabiH97|115700
ATGATCACATACCTTTCCTTAGTCGCTAGTGTTGCACTCCTTGTAGGAGGAGCCTCTGCCCAAACTCAAAGTCAA
TATGGTCAGTGTGGTGGCATTGGCTGGAGCGGTCCTACCCTTTGTCCCAGCGGTTGGTCTTGCCAGAAGCTAAAC
GACTATTACTCTCAATGTCTCCCTGGATCGGCGACGCCAACACCCACAACTACCTCAAATCCGGGAAGTCCTCCA
GTAACCACGCTCCCCCCTACCACCACGAACAATCCGGGTGCAACGCCAACTCTGGCTCCTGGATATTCCTTCATC
AGAGCTGTTGAAGATCCTAACTTCCATAAGTATCTCCGTTCAGAAGTTTCCAGTACCGCCTCGGATGCCGTTCTC
GGAGAACCTGTAGATGCCGCCCAATTCCAGATCACAGGCGGACAACTTGTCCAAAATGCCAATGGCAAATCTCTT
TATGCCATTGTTGAGGCTTACACCGGTGCGGACCAAAAGAAGCTCCAGGTCACTTGGTCTGCTACTCCCTCTACG
TCGGGTGCCTTCTCCTGGAGCGGTGATACAGTCCTATGGCACGATCCCAATGTTCCCCGCCCACAAGACAACGCT
TGGTTGGTCTGTCCCGATGCCGATGGCAACAGGGATTTGTATATCAACTTGGGTCCTTACTCTTACCAGACCCCG
GCTGGCTGCGCCGACGAGACCATTCACGCATATACGGGGTCAACGCCCACTGATTAA
Transcript >AgabiH97|115700
ATGATCACATACCTTTCCTTAGTCGCTAGTGTTGCACTCCTTGTAGGAGGAGCCTCTGCCCAAACTCAAAGTCAA
TATGGTCAGTGTGGTGGCATTGGCTGGAGCGGTCCTACCCTTTGTCCCAGCGGTTGGTCTTGCCAGAAGCTAAAC
GACTATTACTCTCAATGTCTCCCTGGATCGGCGACGCCAACACCCACAACTACCTCAAATCCGGGAAGTCCTCCA
GTAACCACGCTCCCCCCTACCACCACGAACAATCCGGGTGCAACGCCAACTCTGGCTCCTGGATATTCCTTCATC
AGAGCTGTTGAAGATCCTAACTTCCATAAGTATCTCCGTTCAGAAGTTTCCAGTACCGCCTCGGATGCCGTTCTC
GGAGAACCTGTAGATGCCGCCCAATTCCAGATCACAGGCGGACAACTTGTCCAAAATGCCAATGGCAAATCTCTT
TATGCCATTGTTGAGGCTTACACCGGTGCGGACCAAAAGAAGCTCCAGGTCACTTGGTCTGCTACTCCCTCTACG
TCGGGTGCCTTCTCCTGGAGCGGTGATACAGTCCTATGGCACGATCCCAATGTTCCCCGCCCACAAGACAACGCT
TGGTTGGTCTGTCCCGATGCCGATGGCAACAGGGATTTGTATATCAACTTGGGTCCTTACTCTTACCAGACCCCG
GCTGGCTGCGCCGACGAGACCATTCACGCATATACGGGGTCAACGCCCACTGATTAA
Gene >AgabiH97|115700
ATGATCACATACCTTTCCTTAGTCGCTAGTGTTGCACTCCTTGTAGGAGGAGCCTCTGCCCAAACTCAAAGTCAA
TATGGTCAGGTCGGTAGCCGGAAACCTCTACTTTGTTATACCTCTTACTCATAACTCATTCGATGGATTGTCGTT
CACAGTGTGGTGGCATTGGCTGGAGCGGTCCTACCCTTTGTCCCAGCGGTTGGTCTTGCCAGAAGCTAAACGACT
ATTACTCTCAATGTCTCCCTGGATCGGCGACGCCAACACCCACAACTACCTCAAATCCGGGAAGGTGGGATTTGA
TTGTTGGAGGATTGAATCTATCTGATCTTTTTAATAGTCCTCCAGTAACCACGCTCCCCCCTACCACCACGAACA
ATCCGGGTGCAACGCCAACTCTGGCTCCTGGATATTCCTTCATCAGAGCTGTTGTAAGTCCAACCCACTCCAATG
ATCGCTTCATAAGTTATCGTACTCAAATTTCTATAGGAAGATCCTAACTTCCATAAGTATCTCCGTTCAGAAGTT
TCCAGTACCGCCTCGGATGCCGTTCTCGGAGAACCTGTAGATGCCGCCCAATTCCAGATCACAGGCGGACAACTT
GTCCAAAATGCCAATGGCAAATCTCTTTATGCCATTGTTGAGGCTTACACCGGTGCGGACCAAAAGAAGCTCCAG
GTCACTTGGTCTGCTACTCCCTCTACGTCGGGTGCCTTCTCCTGGAGCGGTGATACAGTCCTATGGCACGATCCC
AATGTTCCCCGCCCACAAGACAACGTGAGTTCTGCTTTTTGATTCCGGGTTAAGAATTCGATTTATTATTCACTA
CTTCGTACAGGCTTGGTTGGTCTGTCCCGATGCCGATGGCAACAGGGATTTGTATATCAACTTGGGTCCTTACTC
TTACCAGACCCCGGCTGGCTGCGCCGACGAGACCATTCACGCATATACGGGGTCAACGCCCACTGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail