Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115690
Gene name
Locationscaffold_9:535578..537071
Strand+
Gene length (bp)1493
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 2.8E-154 28 358
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.4E-70 27 271

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q56872|GM4D_YERE8 GDP-mannose 4,6-dehydratase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gmd PE=3 SV=2 25 366 2.0E-171
sp|Q8K0C9|GMDS_MOUSE GDP-mannose 4,6 dehydratase OS=Mus musculus GN=Gmds PE=1 SV=1 24 364 7.0E-171
sp|Q8K3X3|GMDS_CRIGR GDP-mannose 4,6 dehydratase OS=Cricetulus griseus GN=GMDS PE=2 SV=1 24 364 8.0E-171
sp|Q06952|GM4D_VIBCH GDP-mannose 4,6-dehydratase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gmd PE=3 SV=1 24 368 3.0E-170
sp|P0AC90|GM4D_ECO57 GDP-mannose 4,6-dehydratase OS=Escherichia coli O157:H7 GN=gmd PE=3 SV=1 25 366 3.0E-170
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q56872|GM4D_YERE8 GDP-mannose 4,6-dehydratase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gmd PE=3 SV=2 25 366 2.0E-171
sp|Q8K0C9|GMDS_MOUSE GDP-mannose 4,6 dehydratase OS=Mus musculus GN=Gmds PE=1 SV=1 24 364 7.0E-171
sp|Q8K3X3|GMDS_CRIGR GDP-mannose 4,6 dehydratase OS=Cricetulus griseus GN=GMDS PE=2 SV=1 24 364 8.0E-171
sp|Q06952|GM4D_VIBCH GDP-mannose 4,6-dehydratase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gmd PE=3 SV=1 24 368 3.0E-170
sp|P0AC90|GM4D_ECO57 GDP-mannose 4,6-dehydratase OS=Escherichia coli O157:H7 GN=gmd PE=3 SV=1 25 366 3.0E-170
sp|P0AC89|GM4D_ECOL6 GDP-mannose 4,6-dehydratase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gmd PE=3 SV=1 25 366 3.0E-170
sp|P0AC88|GM4D_ECOLI GDP-mannose 4,6-dehydratase OS=Escherichia coli (strain K12) GN=gmd PE=1 SV=1 25 366 3.0E-170
sp|P0AC91|GM4D_SHIFL GDP-mannose 4,6-dehydratase OS=Shigella flexneri GN=gmd PE=3 SV=1 25 366 3.0E-170
sp|Q1ZXF7|GMDS_DICDI GDP-mannose 4,6 dehydratase OS=Dictyostelium discoideum GN=gmd PE=1 SV=1 23 364 8.0E-169
sp|O60547|GMDS_HUMAN GDP-mannose 4,6 dehydratase OS=Homo sapiens GN=GMDS PE=1 SV=1 24 364 9.0E-169
sp|Q9VMW9|GMDS_DROME GDP-mannose 4,6 dehydratase OS=Drosophila melanogaster GN=Gmd PE=1 SV=2 23 364 2.0E-166
sp|P55354|GM4D_RHISN GDP-mannose 4,6-dehydratase OS=Rhizobium sp. (strain NGR234) GN=gmd PE=3 SV=1 24 363 2.0E-166
sp|O85713|GM4D_RHIFH GDP-mannose 4,6-dehydratase OS=Rhizobium fredii (strain HH103) GN=gmd PE=3 SV=1 24 363 1.0E-165
sp|Q56598|GM4D_VIBCL GDP-mannose 4,6-dehydratase OS=Vibrio cholerae GN=gmd PE=3 SV=2 24 366 3.0E-165
sp|Q18801|GMD1_CAEEL GDP-mannose 4,6 dehydratase 1 OS=Caenorhabditis elegans GN=bre-1 PE=1 SV=3 21 363 1.0E-163
sp|O45583|GMD2_CAEEL GDP-mannose 4,6 dehydratase 2 OS=Caenorhabditis elegans GN=gmd-2 PE=1 SV=1 21 363 2.0E-163
sp|A8Y0L5|GMD1_CAEBR GDP-mannose 4,6 dehydratase 1 OS=Caenorhabditis briggsae GN=bre-1 PE=3 SV=2 21 363 3.0E-159
sp|Q9SNY3|GMD1_ARATH GDP-mannose 4,6 dehydratase 1 OS=Arabidopsis thaliana GN=GMD1 PE=1 SV=1 24 366 1.0E-133
sp|P93031|GMD2_ARATH GDP-mannose 4,6 dehydratase 2 OS=Arabidopsis thaliana GN=MUR1 PE=1 SV=3 24 366 9.0E-129
sp|Q9JRN5|GM4D_AGGAC GDP-mannose 4,6-dehydratase OS=Aggregatibacter actinomycetemcomitans GN=gmd PE=1 SV=1 25 364 6.0E-127
sp|Q51366|GM4D_PSEAE GDP-mannose 4,6-dehydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gmd PE=1 SV=2 25 364 2.0E-109
sp|Q6T1X6|RMD_ANETH GDP-6-deoxy-D-mannose reductase OS=Aneurinibacillus thermoaerophilus GN=rmd PE=1 SV=1 27 361 5.0E-31
sp|A0R5C5|GALE_MYCS2 UDP-glucose 4-epimerase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6142 PE=1 SV=2 28 214 5.0E-15
sp|P9WN67|GALE_MYCTU UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=galE1 PE=1 SV=1 27 214 7.0E-15
sp|P9WN66|GALE_MYCTO UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=galE1 PE=3 SV=1 27 214 7.0E-15
sp|Q9HTB6|RMD_PSEAE GDP-6-deoxy-D-mannose reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rmd PE=1 SV=1 102 360 3.0E-14
sp|P0C7J0|RMLB_XANCP dTDP-glucose 4,6-dehydratase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rfbB PE=3 SV=1 85 359 2.0E-12
sp|O06485|YFNG_BACSU Putative sugar dehydratase/epimerase YfnG OS=Bacillus subtilis (strain 168) GN=yfnG PE=3 SV=2 21 297 2.0E-12
sp|Q6ZDJ7|UGE2_ORYSJ UDP-glucose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UGE-2 PE=2 SV=1 25 357 5.0E-12
sp|P33119|GALE_CORDI UDP-glucose 4-epimerase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=galE PE=3 SV=2 28 357 5.0E-12
sp|A0QSK6|RMLB_MYCS2 dTDP-glucose 4,6-dehydratase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rmlB PE=1 SV=1 78 325 5.0E-12
sp|B0RVL0|RMLB_XANCB dTDP-glucose 4,6-dehydratase OS=Xanthomonas campestris pv. campestris (strain B100) GN=rfbB PE=3 SV=1 85 351 7.0E-12
sp|D4GU72|AGL12_HALVD Low-salt glycan biosynthesis protein Agl12 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=agl12 PE=3 SV=1 85 316 2.0E-11
sp|Q6K2E1|UGE4_ORYSJ UDP-glucose 4-epimerase 4 OS=Oryza sativa subsp. japonica GN=UGE-4 PE=2 SV=1 25 357 2.0E-11
sp|P26391|RMLB_SALTY dTDP-glucose 4,6-dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbB PE=1 SV=1 78 359 4.0E-11
sp|Q8VDR7|TGDS_MOUSE dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=Tgds PE=2 SV=2 17 359 8.0E-11
sp|P14169|RFBE_SALTI CDP-paratose 2-epimerase OS=Salmonella typhi GN=rfbE PE=1 SV=2 28 257 2.0E-10
sp|P9WN65|RMLB_MYCTU dTDP-glucose 4,6-dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rmlB PE=1 SV=1 78 265 2.0E-10
sp|P9WN64|RMLB_MYCTO dTDP-glucose 4,6-dehydratase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rmlB PE=3 SV=1 78 265 2.0E-10
sp|P37777|RMLB_SHIFL dTDP-glucose 4,6-dehydratase OS=Shigella flexneri GN=rfbB PE=3 SV=2 79 359 3.0E-10
sp|P37761|RMLB_NEIGO dTDP-glucose 4,6-dehydratase OS=Neisseria gonorrhoeae GN=rfbB PE=3 SV=1 24 359 4.0E-10
sp|A6QLW2|TGDS_BOVIN dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TGDS PE=2 SV=1 15 359 5.0E-10
sp|P27830|RMLB2_ECOLI dTDP-glucose 4,6-dehydratase 2 OS=Escherichia coli (strain K12) GN=rffG PE=1 SV=3 24 262 5.0E-10
sp|Q9S642|RMLB_NEIMA dTDP-glucose 4,6-dehydratase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rfbB1 PE=3 SV=1 86 359 1.0E-09
sp|P37759|RMLB1_ECOLI dTDP-glucose 4,6-dehydratase 1 OS=Escherichia coli (strain K12) GN=rfbB PE=3 SV=2 79 359 1.0E-09
sp|P13226|GALE_STRLI UDP-glucose 4-epimerase OS=Streptomyces lividans GN=galE PE=3 SV=2 28 293 1.0E-09
sp|P21977|GALE_STRTR UDP-glucose 4-epimerase OS=Streptococcus thermophilus GN=galE PE=3 SV=1 28 361 2.0E-09
sp|Q9T0A7|UGE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=UGE2 PE=1 SV=1 25 358 2.0E-09
sp|P44914|RMLB_HAEIN dTDP-glucose 4,6-dehydratase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rffG PE=3 SV=1 86 359 2.0E-09
sp|P55462|RFBB_RHISN Probable dTDP-glucose 4,6-dehydratase OS=Rhizobium sp. (strain NGR234) GN=NGR_a03580 PE=3 SV=1 28 359 4.0E-09
sp|Q57664|GALE_METJA Putative UDP-glucose 4-epimerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0211 PE=3 SV=1 28 359 5.0E-09
sp|P29782|RMLB_STRGR dTDP-glucose 4,6-dehydratase OS=Streptomyces griseus GN=strE PE=1 SV=1 79 311 6.0E-09
sp|Q9SN58|UGE5_ARATH UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana GN=UGE5 PE=1 SV=3 28 358 7.0E-09
sp|P55294|RMLB_NEIMB dTDP-glucose 4,6-dehydratase OS=Neisseria meningitidis serogroup B (strain MC58) GN=rfbB1 PE=3 SV=2 86 359 2.0E-08
sp|O95455|TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=TGDS PE=1 SV=1 25 359 3.0E-08
sp|Q6DF08|UXS1_XENTR UDP-glucuronic acid decarboxylase 1 OS=Xenopus tropicalis GN=uxs1 PE=2 SV=1 17 293 4.0E-08
sp|Q8LNZ3|UGE1_ORYSJ UDP-glucose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UGE-1 PE=2 SV=1 25 358 6.0E-08
sp|Q45291|GALE_CORGL UDP-glucose 4-epimerase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=galE PE=3 SV=2 28 345 6.0E-08
sp|Q8NBZ7|UXS1_HUMAN UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens GN=UXS1 PE=1 SV=1 17 321 8.0E-08
sp|Q5R885|UXS1_PONAB UDP-glucuronic acid decarboxylase 1 OS=Pongo abelii GN=UXS1 PE=2 SV=1 17 321 8.0E-08
sp|Q5PQX0|UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus GN=Uxs1 PE=1 SV=1 17 321 9.0E-08
sp|Q91XL3|UXS1_MOUSE UDP-glucuronic acid decarboxylase 1 OS=Mus musculus GN=Uxs1 PE=1 SV=1 17 321 9.0E-08
sp|Q8H0B2|ARAE3_ORYSJ Probable UDP-arabinose 4-epimerase 3 OS=Oryza sativa subsp. japonica GN=UEL-3 PE=2 SV=1 28 297 1.0E-07
sp|Q8VZC0|UXS1_ARATH UDP-glucuronic acid decarboxylase 1 OS=Arabidopsis thaliana GN=UXS1 PE=1 SV=1 23 360 1.0E-07
sp|P95780|RMLB_STRMU dTDP-glucose 4,6-dehydratase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rmlB PE=1 SV=2 25 292 2.0E-07
sp|O65781|GALE2_CYATE UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetragonoloba PE=2 SV=1 25 357 2.0E-07
sp|Q9ZAE8|RMLB_ACTS5 dTDP-glucose 4,6-dehydratase OS=Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110) GN=acbB PE=3 SV=2 64 263 3.0E-07
sp|Q9SA77|ARAE1_ARATH UDP-arabinose 4-epimerase 1 OS=Arabidopsis thaliana GN=MUR4 PE=1 SV=1 28 348 5.0E-07
sp|P39858|CAPI_STAAU Protein CapI OS=Staphylococcus aureus GN=capI PE=3 SV=1 28 266 6.0E-07
sp|Q8S8T4|UXS4_ARATH UDP-glucuronic acid decarboxylase 4 OS=Arabidopsis thaliana GN=UXS4 PE=2 SV=1 23 359 1.0E-06
sp|P26397|RFBG_SALTY CDP-glucose 4,6-dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbG PE=1 SV=1 19 186 1.0E-06
sp|P75517|GALE_MYCPN UDP-glucose 4-epimerase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=galE PE=3 SV=1 23 186 2.0E-06
sp|Q5UR12|TGDS_MIMIV Putative dTDP-D-glucose 4,6-dehydratase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R141 PE=3 SV=1 75 297 3.0E-06
sp|P47364|GALE_MYCGE UDP-glucose 4-epimerase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=galE PE=3 SV=1 23 184 3.0E-06
sp|Q6GMI9|UXS1_DANRE UDP-glucuronic acid decarboxylase 1 OS=Danio rerio GN=uxs1 PE=2 SV=2 17 286 4.0E-06
sp|Q43070|GALE1_PEA UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE PE=2 SV=1 28 357 5.0E-06
sp|B0M3E8|UGE1_PEA Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Pisum sativum GN=UGE1 PE=1 SV=2 28 357 8.0E-06
sp|Q9LPG6|RHM2_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 OS=Arabidopsis thaliana GN=RHM2 PE=1 SV=1 22 199 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115690
MSIPEALPAFVKLDLPPPEEYHKRKVALISGITGQDGSYLTELLLEKGYQVHGIIRRSSSFNTGRLHHLYEDQHE
RPNKFHLHYGDLSDSTNLVYIIAQVQPTEIYNLGAQSHVKVSFEMAEYTGDVDGLGTLRLLDAIRTCGLEKHVRF
YQASTSELYGKVVETPQSETTPFYPRSPYGCAKLYAFWITVNYRESYGIYACNGILFNHESPRRGRTFVTRKITR
AAAEISLGKQGCLYLGNIDALRDWGHARDYVEGMWLMLQQPTPSDFVLATGEMHSVREFTEKSFKEVGMKLEWSG
HGEQEHAIDKKSGKTVVRVDPKYFRPAEVELLLGNPAKAEKHLGWKRKVSFNSLVKEMVAADLKAAGSLVEDQN*
Coding >AgabiH97|115690
ATGTCCATCCCAGAAGCTCTTCCTGCCTTCGTCAAGCTCGATCTCCCGCCCCCTGAAGAATACCATAAACGCAAG
GTCGCGTTGATCTCTGGTATCACCGGCCAGGACGGCTCATATCTCACCGAACTTCTGTTGGAAAAAGGATATCAA
GTCCACGGCATCATTCGACGATCATCAAGTTTCAACACTGGTCGCCTGCACCATTTGTATGAGGACCAGCATGAA
CGGCCAAATAAATTCCACCTTCATTACGGTGATTTGAGTGATAGCACAAACCTCGTCTACATCATTGCCCAAGTT
CAGCCTACGGAGATCTATAACCTCGGTGCTCAGTCTCACGTCAAAGTCTCCTTTGAAATGGCCGAGTACACCGGC
GATGTCGATGGGCTGGGTACCTTGCGCCTCTTGGATGCGATTCGAACTTGTGGTCTAGAGAAGCACGTACGATTC
TATCAAGCATCGACTTCCGAGCTCTATGGAAAGGTGGTCGAGACTCCACAAAGCGAGACTACACCTTTCTACCCC
CGCTCGCCATATGGATGTGCAAAACTTTATGCATTCTGGATTACAGTGAATTACCGAGAGTCCTATGGGATATAC
GCTTGCAACGGTATACTATTCAACCATGAGAGTCCCAGACGAGGAAGGACTTTTGTCACGAGGAAAATTACGCGC
GCGGCAGCGGAAATCTCATTGGGAAAACAAGGATGTCTGTATCTTGGAAATATAGACGCTTTACGCGATTGGGGC
CATGCCCGCGATTACGTAGAAGGAATGTGGCTGATGTTGCAACAACCTACACCGAGCGATTTTGTCCTCGCTACA
GGAGAAATGCATTCTGTGCGAGAGTTTACAGAGAAATCGTTCAAGGAAGTAGGAATGAAACTCGAGTGGTCGGGC
CATGGTGAACAAGAACATGCCATCGACAAAAAGTCAGGCAAGACCGTTGTCAGGGTTGACCCTAAATACTTCCGT
CCTGCCGAAGTAGAGCTCCTTTTGGGTAATCCCGCCAAGGCGGAAAAGCATCTGGGTTGGAAGCGTAAAGTCTCT
TTTAACAGCCTCGTGAAAGAAATGGTCGCTGCCGATCTCAAAGCAGCTGGCAGTCTGGTTGAAGACCAGAACTGA
Transcript >AgabiH97|115690
ATGTCCATCCCAGAAGCTCTTCCTGCCTTCGTCAAGCTCGATCTCCCGCCCCCTGAAGAATACCATAAACGCAAG
GTCGCGTTGATCTCTGGTATCACCGGCCAGGACGGCTCATATCTCACCGAACTTCTGTTGGAAAAAGGATATCAA
GTCCACGGCATCATTCGACGATCATCAAGTTTCAACACTGGTCGCCTGCACCATTTGTATGAGGACCAGCATGAA
CGGCCAAATAAATTCCACCTTCATTACGGTGATTTGAGTGATAGCACAAACCTCGTCTACATCATTGCCCAAGTT
CAGCCTACGGAGATCTATAACCTCGGTGCTCAGTCTCACGTCAAAGTCTCCTTTGAAATGGCCGAGTACACCGGC
GATGTCGATGGGCTGGGTACCTTGCGCCTCTTGGATGCGATTCGAACTTGTGGTCTAGAGAAGCACGTACGATTC
TATCAAGCATCGACTTCCGAGCTCTATGGAAAGGTGGTCGAGACTCCACAAAGCGAGACTACACCTTTCTACCCC
CGCTCGCCATATGGATGTGCAAAACTTTATGCATTCTGGATTACAGTGAATTACCGAGAGTCCTATGGGATATAC
GCTTGCAACGGTATACTATTCAACCATGAGAGTCCCAGACGAGGAAGGACTTTTGTCACGAGGAAAATTACGCGC
GCGGCAGCGGAAATCTCATTGGGAAAACAAGGATGTCTGTATCTTGGAAATATAGACGCTTTACGCGATTGGGGC
CATGCCCGCGATTACGTAGAAGGAATGTGGCTGATGTTGCAACAACCTACACCGAGCGATTTTGTCCTCGCTACA
GGAGAAATGCATTCTGTGCGAGAGTTTACAGAGAAATCGTTCAAGGAAGTAGGAATGAAACTCGAGTGGTCGGGC
CATGGTGAACAAGAACATGCCATCGACAAAAAGTCAGGCAAGACCGTTGTCAGGGTTGACCCTAAATACTTCCGT
CCTGCCGAAGTAGAGCTCCTTTTGGGTAATCCCGCCAAGGCGGAAAAGCATCTGGGTTGGAAGCGTAAAGTCTCT
TTTAACAGCCTCGTGAAAGAAATGGTCGCTGCCGATCTCAAAGCAGCTGGCAGTCTGGTTGAAGACCAGAACTGA
Gene >AgabiH97|115690
ATGTCCATCCCAGAAGCTCTTCCTGCCTTCGTCAAGCTCGATCTCCCGCCCCCTGAAGAATACCATAAACGCAAG
GTCGCGTTGATCTCTGGTAAGTGCACTGGTACACTAAACACGCGAACCGCGGCATTAATAACGCTGATCACGCGC
AGGTATCACCGGCCAGGACGGCTCATATCTGTACGTTATTGAGCGAAACCATTCTCCAGCTGATCCATTGACGAT
CATTAGCACCGAACTTCTGTTGGAAAAAGGATATCAAGTCCACGGCATCATTCGACGATCATCAAGTTTCAACAC
TGGTCGCCTGCACCATTTGTATGAGGACCAGCATGAACGTATGTCACTTCCTATGTCAACCGCGCGATAAGGCAC
TCATTATAGCTCTTTCGCACTTCTCGATGCCATGCAGGGCCAAATAAATTCCACCTTCATTACGGTGATTTGAGT
GATAGCACAAACCTCGTCTACATCATTGCCCAAGTTCAGCCTACGGAGATCTATAACCTCGGTGCTCAGTCTCAC
GTCAAAGTCTCCTTTGAAATGGCCGAGTACACCGGCGATGTCGATGGGCTGGGTACCTTGCGCCTCTTGGATGCG
ATTCGAACTTGTGGTCTAGAGAAGCACGTACGATTCTATCAAGCATCGACTTCCGAGCTCTATGGAAAGGTGGTC
GAGACTCCACAAAGCGAGACTACACCTTTCTACCCCCGCTCGCCATATGGATGTGCAAAACTTTATGCATTCTGG
ATTACAGTGAATTACCGAGAGTCCTATGGGATATACGCTTGCAACGGTATACTATTCAACCATGAGAGTCCCAGA
CGAGGAAGGACTTTTGTCACGAGGAAAATTACGCGCGCGGCAGCGGAAATCTCATTGGGAAAACAAGGATGTCTG
TATCTTGGAAATATAGACGCTTTACGCGATTGGGGCCATGGCATGTCGCTCCGCTTGTTTTTCAAACGCATAATG
CTAAGATTGAATTTTTCTTCTTCAAAGCCCGCGATTACGTAGAAGGAATGTGGCTGATGTTGCAACAACCTACAC
CGAGCGATTTTGTCCTCGCTACAGGAGAAATGCATTCTGTGCGAGAGTTTACAGAGAAATCGTTCAAGGAAGTAG
GAATGAAACTCGAGTGAGATTTTTTCTTCACTGTCTCTTTTCTTATCTCACGGATCTTCTCTGTCTCATGAAGGT
GGTCGGGCCATGGTGAACAAGAACATGCCATCGACAAAAAGTCAGGCAAGACCGTTGTCAGGGTTGACCCTAAAT
ACTTCCGTCCTGCCGAAGTAGAGTGTGTATTCTTCATTCTTCATCGATTCTATGGAGAGTAATTCACTCACTCGT
CGACCAGGCTCCTTTTGGGTAATCCCGCCAAGGCGGAAAAGCATCTGGGTTGGAAGCGTAAAGTCTCTTTTAACA
GCCTCGTGAAAGAAATGGTCGCTGCCGATCTCAAAGCAGCTGGCAGTCTGGTTGAAGACCAGAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail