Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115680
Gene name
Locationscaffold_9:531139..532582
Strand+
Gene length (bp)1443
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 4.3E-51 6 246
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 4.4E-13 47 271

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RBE5|FCL_PONAB GDP-L-fucose synthase OS=Pongo abelii GN=TSTA3 PE=2 SV=1 6 322 4.0E-145
sp|Q13630|FCL_HUMAN GDP-L-fucose synthase OS=Homo sapiens GN=TSTA3 PE=1 SV=1 6 322 1.0E-144
sp|Q8K3X2|FCL_CRIGR GDP-L-fucose synthase OS=Cricetulus griseus GN=TSTA3 PE=2 SV=1 6 322 3.0E-143
sp|P23591|FCL_MOUSE GDP-L-fucose synthase OS=Mus musculus GN=Tsta3 PE=1 SV=3 6 322 2.0E-142
sp|Q55C77|FCL_DICDI GDP-L-fucose synthase OS=Dictyostelium discoideum GN=ger PE=3 SV=1 2 322 5.0E-133
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RBE5|FCL_PONAB GDP-L-fucose synthase OS=Pongo abelii GN=TSTA3 PE=2 SV=1 6 322 4.0E-145
sp|Q13630|FCL_HUMAN GDP-L-fucose synthase OS=Homo sapiens GN=TSTA3 PE=1 SV=1 6 322 1.0E-144
sp|Q8K3X2|FCL_CRIGR GDP-L-fucose synthase OS=Cricetulus griseus GN=TSTA3 PE=2 SV=1 6 322 3.0E-143
sp|P23591|FCL_MOUSE GDP-L-fucose synthase OS=Mus musculus GN=Tsta3 PE=1 SV=3 6 322 2.0E-142
sp|Q55C77|FCL_DICDI GDP-L-fucose synthase OS=Dictyostelium discoideum GN=ger PE=3 SV=1 2 322 5.0E-133
sp|Q9W1X8|FCL_DROME Probable GDP-L-fucose synthase OS=Drosophila melanogaster GN=Gmer PE=2 SV=1 6 322 1.0E-119
sp|O49213|FCL1_ARATH GDP-L-fucose synthase 1 OS=Arabidopsis thaliana GN=GER1 PE=1 SV=3 4 317 5.0E-51
sp|P55353|FCL_RHISN GDP-L-fucose synthase OS=Rhizobium sp. (strain NGR234) GN=fcl PE=3 SV=1 6 317 3.0E-50
sp|Q9LMU0|FCL2_ARATH Putative GDP-L-fucose synthase 2 OS=Arabidopsis thaliana GN=GER2 PE=1 SV=1 4 317 2.0E-47
sp|P32055|FCL_ECOLI GDP-L-fucose synthase OS=Escherichia coli (strain K12) GN=fcl PE=1 SV=2 1 322 2.0E-46
sp|Q67WR2|FCL1_ORYSJ Probable GDP-L-fucose synthase 1 OS=Oryza sativa subsp. japonica GN=Os06g0652400 PE=2 SV=1 6 322 6.0E-45
sp|P33217|FCL_AZOC5 GDP-L-fucose synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=fcl PE=2 SV=2 6 284 5.0E-29
sp|Q67WR5|FCL2_ORYSJ Putative GDP-L-fucose synthase 2 OS=Oryza sativa subsp. japonica GN=Os06g0652300 PE=3 SV=1 4 294 5.0E-28
sp|Q8VDR7|TGDS_MOUSE dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=Tgds PE=2 SV=2 6 324 3.0E-13
sp|Q331Q7|GERKI_STRSQ dTDP-4-oxo-6-deoxy-D-allose reductase OS=Streptomyces sp. GN=gerKI PE=1 SV=1 49 314 1.0E-11
sp|A6QLW2|TGDS_BOVIN dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TGDS PE=2 SV=1 47 329 2.0E-11
sp|O95455|TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=TGDS PE=1 SV=1 47 322 5.0E-11
sp|Q5SFA6|CHMD_STRBI dTDP-4-oxo-6-deoxy-D-allose reductase OS=Streptomyces bikiniensis GN=chmD PE=1 SV=1 49 314 2.0E-10
sp|Q9JRN7|TLD_AGGAC GDP-6-deoxy-D-talose 4-dehydrogenase OS=Aggregatibacter actinomycetemcomitans GN=tld PE=1 SV=1 6 247 4.0E-08
sp|P55462|RFBB_RHISN Probable dTDP-glucose 4,6-dehydratase OS=Rhizobium sp. (strain NGR234) GN=NGR_a03580 PE=3 SV=1 6 317 9.0E-07
sp|Q59745|EXOB_RHILT UDP-glucose 4-epimerase OS=Rhizobium leguminosarum bv. trifolii GN=exoB PE=3 SV=1 1 317 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115680
MSKAVVLVTGGTGLVGQAIKHIIESEPEGSRFGKQPGESWIFASSSEGDLRDPSQSRRLFEKYKPTHVIHLAALV
GGLFKNMKYKLTFLRDNILINDNVLHSSYESKVEKLISCLSTCVFPDKVEYPLDERKIHSGAPHESNFGYAHAKR
LVDVQNHAYKEEFGCNFTSAIPTNVFGPHDNFDLEDSHVIPGLIHKCYLAKQNNTPFVVAGTGKPLRQFIFSWDL
AKLFIWMLREYDDVEPVILSVGEDEEVSIRAVADAIVKAVGFQGDYTFDTKRADGQFRKPASNKKLLSLMGGFEF
TPFDQALDITVDWFLKNYESARTGNANNA*
Coding >AgabiH97|115680
ATGTCTAAGGCTGTGGTATTGGTCACCGGAGGAACCGGCCTAGTCGGACAGGCGATAAAACACATTATCGAATCT
GAACCCGAAGGATCTCGCTTCGGAAAACAACCTGGAGAGTCATGGATATTCGCAAGTTCATCGGAAGGTGATCTC
AGAGATCCCTCTCAATCCCGCCGATTGTTCGAAAAATACAAACCAACTCATGTCATCCACCTCGCTGCTCTCGTT
GGCGGGCTCTTCAAGAATATGAAGTATAAGCTGACATTCCTCCGCGATAACATCCTGATCAACGACAACGTTCTT
CATTCCTCGTACGAATCCAAGGTTGAGAAATTAATCTCTTGTCTTTCTACCTGTGTTTTCCCGGACAAGGTTGAG
TATCCTCTGGATGAACGCAAGATACATAGCGGAGCCCCACACGAGAGCAACTTTGGCTACGCCCACGCCAAGCGT
CTGGTCGATGTGCAAAATCACGCTTACAAAGAGGAATTCGGTTGTAATTTCACCTCTGCAATCCCGACGAATGTG
TTCGGCCCTCACGATAACTTCGACCTCGAGGATTCACACGTAATCCCAGGTTTAATTCACAAATGCTATCTGGCC
AAACAAAATAACACTCCATTTGTTGTTGCCGGCACAGGGAAACCTCTACGCCAGTTTATCTTTTCTTGGGACCTT
GCGAAATTATTCATTTGGATGCTCCGGGAATACGACGATGTAGAGCCTGTAATCCTCTCGGTGGGCGAAGATGAA
GAAGTCAGCATCAGAGCGGTTGCGGATGCTATCGTCAAGGCCGTCGGCTTCCAAGGTGACTATACTTTTGATACC
AAGCGTGCCGACGGTCAATTCCGTAAGCCCGCATCGAATAAGAAGCTCTTAAGTTTGATGGGTGGTTTCGAATTC
ACTCCGTTTGACCAAGCACTGGATATCACAGTTGATTGGTTCCTCAAAAACTACGAGTCGGCAAGGACGGGTAAT
GCAAATAACGCATGA
Transcript >AgabiH97|115680
ATGTCTAAGGCTGTGGTATTGGTCACCGGAGGAACCGGCCTAGTCGGACAGGCGATAAAACACATTATCGAATCT
GAACCCGAAGGATCTCGCTTCGGAAAACAACCTGGAGAGTCATGGATATTCGCAAGTTCATCGGAAGGTGATCTC
AGAGATCCCTCTCAATCCCGCCGATTGTTCGAAAAATACAAACCAACTCATGTCATCCACCTCGCTGCTCTCGTT
GGCGGGCTCTTCAAGAATATGAAGTATAAGCTGACATTCCTCCGCGATAACATCCTGATCAACGACAACGTTCTT
CATTCCTCGTACGAATCCAAGGTTGAGAAATTAATCTCTTGTCTTTCTACCTGTGTTTTCCCGGACAAGGTTGAG
TATCCTCTGGATGAACGCAAGATACATAGCGGAGCCCCACACGAGAGCAACTTTGGCTACGCCCACGCCAAGCGT
CTGGTCGATGTGCAAAATCACGCTTACAAAGAGGAATTCGGTTGTAATTTCACCTCTGCAATCCCGACGAATGTG
TTCGGCCCTCACGATAACTTCGACCTCGAGGATTCACACGTAATCCCAGGTTTAATTCACAAATGCTATCTGGCC
AAACAAAATAACACTCCATTTGTTGTTGCCGGCACAGGGAAACCTCTACGCCAGTTTATCTTTTCTTGGGACCTT
GCGAAATTATTCATTTGGATGCTCCGGGAATACGACGATGTAGAGCCTGTAATCCTCTCGGTGGGCGAAGATGAA
GAAGTCAGCATCAGAGCGGTTGCGGATGCTATCGTCAAGGCCGTCGGCTTCCAAGGTGACTATACTTTTGATACC
AAGCGTGCCGACGGTCAATTCCGTAAGCCCGCATCGAATAAGAAGCTCTTAAGTTTGATGGGTGGTTTCGAATTC
ACTCCGTTTGACCAAGCACTGGATATCACAGTTGATTGGTTCCTCAAAAACTACGAGTCGGCAAGGACGGGTAAT
GCAAATAACGCATGA
Gene >AgabiH97|115680
ATGTCTAAGGCTGTGGTATTGGTCACCGGAGGAACCGGCCTAGTCGGACAGGCGATAAAACACATTATCGAATCT
GAACCCGAAGGATCTCGCTTCGGAAAACAACCTGGAGAGTCATGGATATTCGCAAGTTCATCGGAAGGTGATCTC
AGGTGGGTTAACATGAGCATGATCCCCCGATAATTTTTCATTGATACCCGACAGAGATCCCTCTCAATCCCGCCG
ATTGTTCGAAAAATACAAACCAACTCATGTCATCCACCTCGCTGCTCTCGGTATGTTTCGGTTATGAGCCTTCAT
CACCTGATCCTGACTGAGTGGCATAGTTGGCGGGCTCTTCAAGAATATGAAGTATAAGGTAAACCCTTCCACCAT
TTGGGGTTATCAGCGGCAGCTAAGCGCAGTGATCTACTAGCTGACATTCCTCCGCGATAACATCCTGATCAACGA
CAACGTTCTTCATTCCTCGTACGAATCCAAGGTTGAGAAATTAATCTCTTGTCTTTCTACCTGTGTTTTCCCGGA
CAAGGTTGAGTATCCTCTGGATGAACGCAAGATACATAGCGGAGCCCCACACGAGAGCAACTTTGGCTACGCCCA
CGCCAAGCGTCTGGTCGATGTGCAAAATCAGTAAGCGAGGTGGCTCTCATCGCGCTCGTCCATCTAACGCTACCT
AGCGCTTACAAAGAGGAATTCGGTTGTAATTTCACCTCTGCAATCCCGACGAATGTGTTCGGCCCTCACGATAAC
TTGTAAATTTCATTGCTCTTTCCTAGAAGCAAATCTGATATGAATCAGCGACCTCGAGGATTCACACGTAATCCC
AGGTTTAATTCACAAATGCTATCTGGCCAAACGTATGCATTTAATGTCTTATTTCCCGTGAATGCAATTGACCGA
GCGGCAGAAAATAACACTCCATTTGTTGTTGCCGGCACAGGGAAACCTCTACGCCAGTTTATCTTTTCTTGGGAC
CTTGCGAAATTATTCATTTGGATGCTCCGGGAATACGACGATGTAGAGCCTGTAATCCTCTCGGGTAAGCGCTAT
ACCAAGCCAGTTGATCTCTCATCACTTAATATACGCAGTGGGCGAAGATGAAGAAGTCAGCATCAGAGCGGTTGC
GGATGCTATCGTCAAGGCCGTCGGCTTCCAAGGTGACTATACTGTATGCTGTGCACACCATATATCTTTGACTCG
GACTCATTTTTTGTCTAGTTTGATACCAAGCGTGCCGACGGTCAATTCCGTAAGCCCGCATCGAATAAGAAGCTC
TTAAGTTTGATGGGTGGTTTCGAATTCACTCCGTTTGACCAAGGTGCGATCTGCGTATCGTTTATCGTAAAGTCT
ATCTCATCACGTTCCACAGCACTGGATATCACAGTTGATTGGTTCCTCAAAAACTACGAGTCGGCAAGGACGGGT
AATGCAAATAACGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail