Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115630
Gene name
Locationscaffold_9:518961..520593
Strand+
Gene length (bp)1632
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05179 CDC73_C RNA pol II accessory factor, Cdc73 family, C-terminal 2.7E-55 237 405

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUE7|CDC73_SCHPO Cell division control protein 73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc73 PE=3 SV=1 1 411 6.0E-48
sp|Q06697|CDC73_YEAST Cell division control protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC73 PE=1 SV=1 2 408 1.0E-29
sp|Q5ZLM0|CDC73_CHICK Parafibromin OS=Gallus gallus GN=CDC73 PE=2 SV=1 199 413 9.0E-25
sp|Q8JZM7|CDC73_MOUSE Parafibromin OS=Mus musculus GN=Cdc73 PE=1 SV=1 199 413 1.0E-24
sp|Q6P1J9|CDC73_HUMAN Parafibromin OS=Homo sapiens GN=CDC73 PE=1 SV=1 199 413 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUE7|CDC73_SCHPO Cell division control protein 73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc73 PE=3 SV=1 1 411 6.0E-48
sp|Q06697|CDC73_YEAST Cell division control protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC73 PE=1 SV=1 2 408 1.0E-29
sp|Q5ZLM0|CDC73_CHICK Parafibromin OS=Gallus gallus GN=CDC73 PE=2 SV=1 199 413 9.0E-25
sp|Q8JZM7|CDC73_MOUSE Parafibromin OS=Mus musculus GN=Cdc73 PE=1 SV=1 199 413 1.0E-24
sp|Q6P1J9|CDC73_HUMAN Parafibromin OS=Homo sapiens GN=CDC73 PE=1 SV=1 199 413 1.0E-24
sp|Q4V8C8|CDC73_RAT Parafibromin OS=Rattus norvegicus GN=Cdc73 PE=2 SV=1 199 413 1.0E-24
sp|Q9N5U5|CDC73_CAEEL Cell division cycle protein 73 OS=Caenorhabditis elegans GN=cdc-73 PE=3 SV=4 240 413 2.0E-24
sp|Q9LJ87|CDC73_ARATH Protein CDC73 homolog OS=Arabidopsis thaliana GN=CDC73 PE=1 SV=1 41 408 1.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115630
MDTLSGLRQAISSKTPVAFANDQGPCTALAAATHIVLPTGSVPKSTPTRYRKPGTSGSSPQDFYTTEALYLAWHL
RDAAATEYMKQTRENGLTVGFVSVTERKKVVDVLEGRIPDHDDAIPAAEVESTTPPGSPPRDLRSRSATAPKSSA
AEPTSSPTKRRYAPDYHDAEVVKKIKLSEVELRDRNTVLRGNKPNNFATVRTIFADKLKKLRDAARSGATQPVAT
PDPKLQAKKARNFQPIIIISSSPTALITMYNVKRFLQESTFEPPQEARAHAMAEGNTRPEDLIAIYRRRTHIDSS
GKETESQAKYFVVDSVEALAKFGADAWDRVVCVMTTGQAWQFRPYKWNEPRQLFHHVKGIYVTWSNDPPNPKIQD
WNVTELKIDPHRRHVDKAVVAQFWKILDAWIVSNKPWLMKA*
Coding >AgabiH97|115630
ATGGATACTCTCAGTGGCCTCCGGCAGGCAATATCCTCAAAAACACCCGTCGCCTTTGCAAACGATCAAGGCCCA
TGTACCGCTCTCGCTGCTGCAACCCACATCGTTCTCCCCACCGGTAGTGTGCCAAAGTCAACTCCAACCCGCTAC
CGCAAACCCGGGACGTCGGGATCTTCACCGCAGGATTTCTATACCACCGAAGCTTTATACCTTGCATGGCATTTG
CGTGATGCTGCTGCTACGGAATATATGAAACAGACTCGAGAGAATGGTCTTACGGTTGGCTTTGTCAGTGTCACC
GAGAGGAAAAAGGTAGTGGATGTGCTGGAGGGTCGGATACCTGACCATGATGATGCAATACCTGCAGCTGAAGTT
GAGTCGACGACACCACCGGGCTCACCTCCACGAGATCTTCGTTCACGGTCGGCTACTGCTCCTAAGTCATCAGCT
GCAGAACCTACTTCATCTCCTACAAAACGACGATACGCTCCCGATTATCATGACGCCGAAGTGGTCAAGAAAATC
AAGCTCAGTGAAGTAGAGCTGAGGGACCGAAATACAGTTCTGCGTGGTAACAAACCAAACAACTTTGCTACTGTA
CGAACTATTTTTGCAGATAAACTGAAAAAGCTTAGAGATGCTGCTCGTTCTGGAGCTACTCAGCCTGTTGCGACG
CCAGACCCTAAACTTCAAGCAAAGAAAGCGCGCAATTTCCAACCCATCATCATCATATCATCCTCTCCAACCGCT
CTTATCACCATGTACAACGTCAAACGCTTTCTCCAAGAATCTACCTTTGAACCACCGCAAGAAGCCCGAGCACAC
GCTATGGCAGAAGGCAACACTCGACCCGAAGATCTCATTGCAATTTACCGTCGCCGCACCCACATCGACTCAAGT
GGAAAAGAAACCGAATCTCAAGCAAAATATTTCGTTGTCGATAGCGTTGAAGCTTTAGCCAAATTTGGTGCTGAT
GCTTGGGATAGAGTGGTTTGTGTTATGACTACGGGTCAAGCTTGGCAGTTTCGACCGTACAAGTGGAATGAACCG
AGACAGTTATTCCATCATGTCAAGGGGATTTATGTGACATGGTCAAATGATCCTCCGAACCCCAAAATACAAGAC
TGGAACGTAACAGAGTTAAAGATCGACCCGCATCGACGACACGTTGATAAAGCTGTCGTCGCTCAATTTTGGAAA
ATTCTCGACGCTTGGATTGTGTCGAATAAACCATGGTTAATGAAAGCTTAA
Transcript >AgabiH97|115630
ATGGATACTCTCAGTGGCCTCCGGCAGGCAATATCCTCAAAAACACCCGTCGCCTTTGCAAACGATCAAGGCCCA
TGTACCGCTCTCGCTGCTGCAACCCACATCGTTCTCCCCACCGGTAGTGTGCCAAAGTCAACTCCAACCCGCTAC
CGCAAACCCGGGACGTCGGGATCTTCACCGCAGGATTTCTATACCACCGAAGCTTTATACCTTGCATGGCATTTG
CGTGATGCTGCTGCTACGGAATATATGAAACAGACTCGAGAGAATGGTCTTACGGTTGGCTTTGTCAGTGTCACC
GAGAGGAAAAAGGTAGTGGATGTGCTGGAGGGTCGGATACCTGACCATGATGATGCAATACCTGCAGCTGAAGTT
GAGTCGACGACACCACCGGGCTCACCTCCACGAGATCTTCGTTCACGGTCGGCTACTGCTCCTAAGTCATCAGCT
GCAGAACCTACTTCATCTCCTACAAAACGACGATACGCTCCCGATTATCATGACGCCGAAGTGGTCAAGAAAATC
AAGCTCAGTGAAGTAGAGCTGAGGGACCGAAATACAGTTCTGCGTGGTAACAAACCAAACAACTTTGCTACTGTA
CGAACTATTTTTGCAGATAAACTGAAAAAGCTTAGAGATGCTGCTCGTTCTGGAGCTACTCAGCCTGTTGCGACG
CCAGACCCTAAACTTCAAGCAAAGAAAGCGCGCAATTTCCAACCCATCATCATCATATCATCCTCTCCAACCGCT
CTTATCACCATGTACAACGTCAAACGCTTTCTCCAAGAATCTACCTTTGAACCACCGCAAGAAGCCCGAGCACAC
GCTATGGCAGAAGGCAACACTCGACCCGAAGATCTCATTGCAATTTACCGTCGCCGCACCCACATCGACTCAAGT
GGAAAAGAAACCGAATCTCAAGCAAAATATTTCGTTGTCGATAGCGTTGAAGCTTTAGCCAAATTTGGTGCTGAT
GCTTGGGATAGAGTGGTTTGTGTTATGACTACGGGTCAAGCTTGGCAGTTTCGACCGTACAAGTGGAATGAACCG
AGACAGTTATTCCATCATGTCAAGGGGATTTATGTGACATGGTCAAATGATCCTCCGAACCCCAAAATACAAGAC
TGGAACGTAACAGAGTTAAAGATCGACCCGCATCGACGACACGTTGATAAAGCTGTCGTCGCTCAATTTTGGAAA
ATTCTCGACGCTTGGATTGTGTCGAATAAACCATGGTTAATGAAAGCTTAA
Gene >AgabiH97|115630
ATGGATACTCTCAGTGGCCTCCGGCAGGCAATATCCTCAAAAACACCCGTCGCCTTTGCAAACGATCAAGGCCCA
TGTACCGCTCTCGCTGCTGCAACCCACATCGTTCTCCCCACCGGTAGTGTGCCAAAGTCAACTCCAACCCGCTAC
CGCAAACCCGGGACGTCGGGATCTTCACCGCAGGATTTCTATACCACCGAAGCTTTATACCTTGCATGGCATTTG
CGTGATGCTGCTGCTACGGAATATATGAAACAGACTCGAGAGAATGGTCTTACGGTTGGCTTTGTCAGTGTCACC
GAGAGGAAAAAGGTAGTGGATGTGCTGGAGGGTCGGATACCTGACCATGATGATGCAATACCTGCAGCTGAAGGT
GGGAGCTCATCCTGTTCCTTTTCAGAGCAGCACTTAACTTTGTTTCGGTTAGTTGAGTCGACGACACCACCGGGC
TCACCTCCACGAGATCTTCGTTCACGGTCGGCTACTGCTCCTAAGTCATCAGCTGCAGAACCTACTTCATCTCCT
ACAAAACGACGATACGCTCCCGATTATCATGACGCCGAAGTGGTCAAGAAAATCAAGCTCAGTGAAGTAGAGCTG
AGGGACCGAAATACAGTTCTGCGTGGTAACAAACCAAACGTGCGTTTATTACTCCGCTATGCATCTTTAGCTGAC
TGTCCGTCAGAACTTTGCTACTGTACGAACTATTTTTGCAGATAAACTGAAAAAGCTTAGAGATGCTGCTCGTTC
TGGAGCTACTCAGCCTGTTGCGACGCCAGGTGTGCAATTCAGATATGATCCTACCCCGTAAATAAAGTTTGCTAA
CTTTATGTTTTTATCATTCAGACCCTAAACTTCAAGCAAAGAAAGCGCGTCAGTCTTTCATGTTAGTCTAAACCT
TCATCTCCGTTAACGTCTTATAGGCAATTTCCAACCCATCATCATCATATCATCCTCTCCAACCGCTCTTATCAC
CATGTACAACGTCAAACGCTTTCTCCAAGAATCTACGTGAGCCTTCAACATATCCAATCTCTACAATCTCTAATA
GTTTCAAATAACACAGCTTTGAACCACCGCAAGAAGCCCGAGCACACGCTATGGCAGAAGGCAACACTCGACCCG
AAGATCTCATTGCAATTTACCGTCGCCGCACCCACATCGACTCAAGTGGAAAAGAAACCGAATCTCAAGCAAAAT
ATTTCGTTGTCGATAGCGTTGAAGCTTTAGCCAAATTTGGTGCTGATGCTTGGGATAGAGTGGTTTGTGTTATGA
CTACGGGTCAAGCTTGGCAGTTTCGACCGTACAAGTGGAATGAACCGAGACAGTTATTCCATCATGGTAGGTTTT
TGCTGCAACTCGATAATTCATTATGTTGATTATTTTTATCTTGATAGTCAAGGGGATTTATGTGACATGGTCAAA
TGATCCTCCGAACCCCAAAATACAAGACTGGAACGTAACAGAGTTAAAGGTATAATGGCTTCCCGGTCATCGTAG
ATATTGTGACTCAAATGGCTATTTTAGATCGACCCGCATCGACGACACGTTGATAAAGCTGTCGTCGCTCAATTT
TGGAAAATTCTCGACGCTTGGATTGTGTCGAATAAACCATGGTTAATGAAAGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail