Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115560
Gene name
Locationscaffold_9:505556..507855
Strand+
Gene length (bp)2299
Transcript length (bp)1449
Coding sequence length (bp)1449
Protein length (aa) 483

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 4.1E-46 37 383
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 1.0E-09 216 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55CD9|NDH_DICDI Probable NADH dehydrogenase OS=Dictyostelium discoideum GN=DDB_G0270104 PE=3 SV=2 8 482 1.0E-89
sp|M0ZYF3|INDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=3 SV=1 27 482 5.0E-87
sp|O80874|NDA2_ARATH Internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial OS=Arabidopsis thaliana GN=NDA2 PE=2 SV=1 7 482 2.0E-86
sp|Q9ST63|NDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=1 SV=1 27 482 2.0E-84
sp|Q8GWA1|NDA1_ARATH Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Arabidopsis thaliana GN=NDA1 PE=2 SV=1 27 482 9.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55CD9|NDH_DICDI Probable NADH dehydrogenase OS=Dictyostelium discoideum GN=DDB_G0270104 PE=3 SV=2 8 482 1.0E-89
sp|M0ZYF3|INDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=3 SV=1 27 482 5.0E-87
sp|O80874|NDA2_ARATH Internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial OS=Arabidopsis thaliana GN=NDA2 PE=2 SV=1 7 482 2.0E-86
sp|Q9ST63|NDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=1 SV=1 27 482 2.0E-84
sp|Q8GWA1|NDA1_ARATH Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Arabidopsis thaliana GN=NDA1 PE=2 SV=1 27 482 9.0E-80
sp|O43090|NDH2_SCHPO Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.15c PE=3 SV=1 35 477 2.0E-75
sp|Q07500|NDH2_YEAST External NADH-ubiquinone oxidoreductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE2 PE=1 SV=1 34 478 8.0E-74
sp|O14121|NDH1_SCHPO Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.07 PE=3 SV=1 35 480 6.0E-73
sp|M1BYJ7|ENDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=3 SV=1 34 369 1.0E-72
sp|Q9ST62|NDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=1 SV=1 34 369 2.0E-72
sp|F2Z699|NDH2_YARLI External alternative NADH-ubiquinone oxidoreductase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NDH2 PE=1 SV=1 5 481 3.0E-72
sp|P40215|NDH1_YEAST External NADH-ubiquinone oxidoreductase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE1 PE=1 SV=1 34 478 1.0E-70
sp|Q1JPL4|NDB1_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Arabidopsis thaliana GN=NDB1 PE=1 SV=1 38 369 6.0E-68
sp|Q94BV7|NDB2_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial OS=Arabidopsis thaliana GN=NDB2 PE=1 SV=1 34 369 8.0E-64
sp|Q9SKT7|NDB4_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B4, mitochondrial OS=Arabidopsis thaliana GN=NDB4 PE=1 SV=1 35 369 1.0E-63
sp|P32340|NDI1_YEAST Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDI1 PE=1 SV=1 34 479 3.0E-61
sp|F4JJJ3|NDB3_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial OS=Arabidopsis thaliana GN=NDB3 PE=2 SV=1 35 369 1.0E-59
sp|P00393|DHNA_ECOLI NADH dehydrogenase OS=Escherichia coli (strain K12) GN=ndh PE=1 SV=2 56 452 4.0E-28
sp|Q5HQM1|Y527_STAEQ NADH dehydrogenase-like protein SERP0527 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0527 PE=3 SV=1 32 438 3.0E-25
sp|Q8CPV5|Y635_STAES NADH dehydrogenase-like protein SE_0635 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0635 PE=3 SV=1 32 438 2.0E-24
sp|Q5HHE4|Y944_STAAC NADH dehydrogenase-like protein SACOL0944 OS=Staphylococcus aureus (strain COL) GN=SACOL0944 PE=3 SV=1 32 438 5.0E-24
sp|Q99VE0|Y941_STAAM NADH dehydrogenase-like protein SAV0941 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0941 PE=3 SV=1 32 438 5.0E-24
sp|Q6GIE7|Y903_STAAR NADH dehydrogenase-like protein SAR0903 OS=Staphylococcus aureus (strain MRSA252) GN=SAR0903 PE=3 SV=1 32 438 5.0E-24
sp|Q2FZV7|Y878_STAA8 NADH dehydrogenase-like protein SAOUHSC_00878 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00878 PE=1 SV=1 32 438 5.0E-24
sp|Q2FID4|Y844_STAA3 NADH dehydrogenase-like protein SAUSA300_0844 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0844 PE=3 SV=1 32 438 5.0E-24
sp|Q7A6J4|Y802_STAAN NADH dehydrogenase-like protein SA0802 OS=Staphylococcus aureus (strain N315) GN=SA0802 PE=1 SV=1 32 438 5.0E-24
sp|Q6GAY5|Y811_STAAS NADH dehydrogenase-like protein SAS0811 OS=Staphylococcus aureus (strain MSSA476) GN=SAS0811 PE=3 SV=1 32 438 7.0E-24
sp|Q8NXG0|Y823_STAAW NADH dehydrogenase-like protein MW0823 OS=Staphylococcus aureus (strain MW2) GN=MW0823 PE=3 SV=1 32 438 7.0E-24
sp|Q4L4V6|Y2010_STAHJ NADH dehydrogenase-like protein SH2010 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH2010 PE=3 SV=1 32 438 9.0E-24
sp|Q2YWP9|Y807_STAAB NADH dehydrogenase-like protein SAB0807 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB0807 PE=3 SV=1 32 438 9.0E-24
sp|Q49W80|Y1834_STAS1 NADH dehydrogenase-like protein SSP1834 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1834 PE=3 SV=1 32 438 3.0E-22
sp|P44856|DHNA_HAEIN NADH dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ndh PE=3 SV=1 139 420 4.0E-21
sp|O05267|YUMB_BACSU NADH dehydrogenase-like protein YumB OS=Bacillus subtilis (strain 168) GN=yumB PE=3 SV=1 32 438 1.0E-20
sp|O32117|YUTJ_BACSU NADH dehydrogenase-like protein YutJ OS=Bacillus subtilis (strain 168) GN=yutJ PE=3 SV=2 153 391 5.0E-17
sp|P80861|YJLD_BACSU NADH dehydrogenase-like protein YjlD OS=Bacillus subtilis (strain 168) GN=yjlD PE=1 SV=3 150 455 5.0E-15
sp|Q8GXR9|DHNA_ARATH Alternative NAD(P)H-ubiquinone oxidoreductase C1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=NDC1 PE=1 SV=2 34 419 2.0E-13
sp|Q1JPL4|NDB1_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Arabidopsis thaliana GN=NDB1 PE=1 SV=1 372 482 3.0E-07
sp|P42433|NASB_BACSU Assimilatory nitrate reductase electron transfer subunit OS=Bacillus subtilis (strain 168) GN=nasB PE=2 SV=2 34 365 7.0E-07
sp|Q9ST62|NDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=1 SV=1 372 482 1.0E-06
sp|M1BYJ7|ENDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=3 SV=1 372 482 2.0E-06
sp|Q9SKT7|NDB4_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B4, mitochondrial OS=Arabidopsis thaliana GN=NDB4 PE=1 SV=1 372 478 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115560
MQGLLNHSSSLNASSFRAARFCIARKFSSTAAREKQRVVILGSGWGGYGLLRGIDKKRYDVVVISPTTYFNFTPL
LASTAVGTLEFRTAIEPVRRYVPAAVYYQAWCDNIDFSRKTLTCMPATRPITRESSDPTKVDDPNYRASANIPFT
ARYDKLIIAVGAYSQTFNIPGVKEHAYFLKDVKDARRIRSRILECFEQANQPVISDVERRNLLNFCVVGGGPTGV
EFAAELHDLLQTDVRTHYPDLARFTNITLYDVADSILSSFDQSLVKYTEKMFSREGVHILTNHHVERVEAGKLFI
REKGEVPFGLLVWSTGLAPNPLVSAMSGVKKNPKTQSVITNDQLNVIMQETNEPNPDVWAIGDAATFEEAPLPAT
AQVASQKAHYMITKLNTLAKDKDHCEPFEFHNQGSLAYIGNWNAIYDRSSTLPEGEKDKFMSKETGRVAWLLWRS
AYFTMTLSWRNKILVPTYWFLNWMFGRDMTRF*
Coding >AgabiH97|115560
ATGCAGGGGCTTCTTAATCACTCCTCTAGTCTCAATGCCTCTTCTTTCCGCGCCGCTCGTTTCTGCATCGCGCGA
AAGTTCAGCTCAACGGCAGCGAGAGAGAAACAACGAGTCGTGATTTTAGGGTCTGGATGGGGCGGCTACGGTCTA
CTACGAGGGATTGACAAGAAGCGTTACGATGTCGTTGTTATCTCGCCTACGACGTATTTCAACTTTACACCTCTC
CTAGCTAGCACTGCTGTTGGAACACTCGAATTTCGGACTGCCATTGAACCAGTTCGAAGATATGTCCCTGCCGCG
GTATACTATCAAGCTTGGTGCGATAATATTGATTTTAGTCGCAAGACCTTGACATGCATGCCTGCCACACGGCCA
ATAACAAGAGAATCATCGGACCCAACCAAAGTTGACGATCCTAATTACCGAGCCTCGGCCAACATTCCATTTACT
GCGCGTTACGATAAGCTTATAATCGCTGTTGGTGCTTATTCTCAAACCTTCAATATTCCTGGAGTGAAGGAACAT
GCCTACTTCCTAAAAGATGTCAAAGATGCACGCCGAATCCGCAGTAGAATTCTTGAATGTTTCGAACAGGCAAAC
CAGCCAGTTATATCTGACGTCGAGCGTCGTAATCTGCTCAATTTCTGTGTAGTTGGTGGAGGCCCAACAGGCGTC
GAGTTTGCTGCAGAACTACACGATTTACTGCAGACGGACGTCCGTACTCATTATCCTGACCTCGCGAGATTTACA
AATATCACGCTCTATGATGTTGCTGACAGCATTCTGAGTAGTTTTGATCAGTCACTTGTGAAATACACCGAGAAA
ATGTTCTCTCGTGAAGGCGTTCACATTCTCACAAATCATCATGTAGAACGCGTCGAAGCGGGAAAATTGTTTATA
CGGGAAAAGGGAGAAGTGCCTTTTGGGCTTCTTGTCTGGTCTACGGGCCTCGCACCAAATCCACTTGTTTCAGCA
ATGAGCGGAGTCAAGAAGAACCCTAAGACCCAAAGCGTCATCACCAACGACCAGCTCAATGTTATCATGCAAGAA
ACGAATGAACCAAATCCGGATGTCTGGGCTATCGGTGACGCAGCGACCTTTGAAGAGGCACCCTTACCAGCAACG
GCTCAAGTCGCCTCCCAGAAAGCGCATTACATGATTACCAAACTTAATACTCTCGCGAAGGATAAGGACCATTGT
GAACCCTTCGAGTTCCATAACCAGGGCAGTCTGGCGTACATTGGGAACTGGAATGCTATCTACGATCGTTCTTCG
ACACTTCCGGAAGGAGAGAAGGACAAATTCATGTCGAAAGAAACAGGACGAGTAGCTTGGTTACTTTGGCGTTCC
GCGTACTTTACTATGACGCTCAGTTGGAGGAACAAGATCTTGGTGCCAACTTACTGGTTTTTAAATTGGATGTTT
GGGAGAGACATGACTCGATTCTAG
Transcript >AgabiH97|115560
ATGCAGGGGCTTCTTAATCACTCCTCTAGTCTCAATGCCTCTTCTTTCCGCGCCGCTCGTTTCTGCATCGCGCGA
AAGTTCAGCTCAACGGCAGCGAGAGAGAAACAACGAGTCGTGATTTTAGGGTCTGGATGGGGCGGCTACGGTCTA
CTACGAGGGATTGACAAGAAGCGTTACGATGTCGTTGTTATCTCGCCTACGACGTATTTCAACTTTACACCTCTC
CTAGCTAGCACTGCTGTTGGAACACTCGAATTTCGGACTGCCATTGAACCAGTTCGAAGATATGTCCCTGCCGCG
GTATACTATCAAGCTTGGTGCGATAATATTGATTTTAGTCGCAAGACCTTGACATGCATGCCTGCCACACGGCCA
ATAACAAGAGAATCATCGGACCCAACCAAAGTTGACGATCCTAATTACCGAGCCTCGGCCAACATTCCATTTACT
GCGCGTTACGATAAGCTTATAATCGCTGTTGGTGCTTATTCTCAAACCTTCAATATTCCTGGAGTGAAGGAACAT
GCCTACTTCCTAAAAGATGTCAAAGATGCACGCCGAATCCGCAGTAGAATTCTTGAATGTTTCGAACAGGCAAAC
CAGCCAGTTATATCTGACGTCGAGCGTCGTAATCTGCTCAATTTCTGTGTAGTTGGTGGAGGCCCAACAGGCGTC
GAGTTTGCTGCAGAACTACACGATTTACTGCAGACGGACGTCCGTACTCATTATCCTGACCTCGCGAGATTTACA
AATATCACGCTCTATGATGTTGCTGACAGCATTCTGAGTAGTTTTGATCAGTCACTTGTGAAATACACCGAGAAA
ATGTTCTCTCGTGAAGGCGTTCACATTCTCACAAATCATCATGTAGAACGCGTCGAAGCGGGAAAATTGTTTATA
CGGGAAAAGGGAGAAGTGCCTTTTGGGCTTCTTGTCTGGTCTACGGGCCTCGCACCAAATCCACTTGTTTCAGCA
ATGAGCGGAGTCAAGAAGAACCCTAAGACCCAAAGCGTCATCACCAACGACCAGCTCAATGTTATCATGCAAGAA
ACGAATGAACCAAATCCGGATGTCTGGGCTATCGGTGACGCAGCGACCTTTGAAGAGGCACCCTTACCAGCAACG
GCTCAAGTCGCCTCCCAGAAAGCGCATTACATGATTACCAAACTTAATACTCTCGCGAAGGATAAGGACCATTGT
GAACCCTTCGAGTTCCATAACCAGGGCAGTCTGGCGTACATTGGGAACTGGAATGCTATCTACGATCGTTCTTCG
ACACTTCCGGAAGGAGAGAAGGACAAATTCATGTCGAAAGAAACAGGACGAGTAGCTTGGTTACTTTGGCGTTCC
GCGTACTTTACTATGACGCTCAGTTGGAGGAACAAGATCTTGGTGCCAACTTACTGGTTTTTAAATTGGATGTTT
GGGAGAGACATGACTCGATTCTAG
Gene >AgabiH97|115560
ATGCAGGGGCTTCTTAATCACTCCTCTAGTCTCAATGCCTCTTCTTTCCGCGCCGCTCGTTTCTGCATCGCGCGA
AAGTTCAGCTCAACGGCAGCGAGAGAGAAACAACGAGTCGTGATTTTAGGGTCTGGATGGGGCGGCTACGGTCTA
CTACGAGGGATTGACAAGAAGCGTTACGGTATGTTCTTTTTGATGTTATTCTTTTTCCCAAAGGTTACTCGGCTA
ATTGATGCACATAGATGTCGTTGTTATCTCGCCTACGACGTATTTCAACTTTACACCTCTCCTAGCTAGCACTGC
TGTTGGAACACTCGAATTTCGGACTGCCATTGAACCAGTCAGTGTTTTCGGTTTGTAGGTTAGCTACGTGGTTGT
CTCACACACTCTCAGGTTCGAAGATATGTCCCTGCCGCGGTGCGTAATCGGCATTTAGACATGTTTTTTTTGGCT
GAGGTGGCAGGATAGGTATACTATCAAGCTTGGTGCGATAATATTGGTATGCCCTGCCTTTCCTTCTACTTTTCC
CGACCAAATTTGGACCTTTGAACAGATTTTAGTCGCAAGACCTTGACATGCGTGAGTACCCATGCTGCTGAAGTA
CCTTGATTCATACCGACTTTTCGGTTTTCATAGATGCCTGCCACACGGCCAATAACAAGAGAATCATCGGACCCA
ACCAAAGTTGACGATCCTAATTACCGAGCCTCGGCCAACATTCCATTTACTGCGCGTTACGATAAGCTTATAATC
GCTGTTGGTGCTTATTCTCAAAGTATGCACTGTCTGTTGCTTTCTCTGGCAAAAAGTGCTTATGTCTTCCAGCCT
TCAATATTCCTGGAGTGAAGGAACATGCCTACTTCCTAAAAGATGTCAAAGATGCACGCCGAATCCGCAGTAGAA
TTCTTGAATGTATGTTTCACTCTAATCCTGGGCTCATATGTTTGAACTCATTGAATCGGATAGGTTTCGAACAGG
CAAACCAGCCAGTTATATCTGACGTCGAGCGTCGTAATCTGCTCAATTTCTGTGTAGTTGGTATGCAGCCGCCTT
CACCGAATCTGATAACGAGTTAATTCGGTCTTCTGAAGGTGGAGGCCCAACAGGCGTCGAGTTTGCTGCAGAACT
ACACGATTTACTGCAGACGGACGTCCGTACTCATTATCCTGACCTCGCGAGATTTACAAATATCACGCTCTATGA
TGTTGCTGACAGCATTCTGAGTAGTTTTGATCAGTCACTTGTGAAGTACATATATTTCTTTTATATCAGCACAAC
GCTCACCAGATGAATAAAGATACACCGAGAAAATGTTCTCTCGTGAAGGCGTTCACATTCTCACAAATCATCATG
TAGAACGCGTCGAAGCGGTATAGCTCTAAACTTCTCATTGTAAAATTATTATGCTAAACGACTTGAAGGGAAAAT
TGTTTATACGGGAAAAGGGAGAAGGTATGTATGCCTTTTGCGTCCCCGTTATACGTTATTGAACTGGCGACAGTG
CCTTTTGGGCTTCTTGTCTGGTCTACGGGCCTCGCACCAAATCCACTTGTTTCAGCAATGAGCGGAGTCAAGAAG
AACCCTAAGACCCAAAGGTTCGTCCATAGATTATCCGATGGCCATTGATTTACCATATATCGATCGGGCGAATTT
CAGCGTCATCACCAACGACCAGCTCAATGTTATCATGCAAGAAACGAATGAACCAAATCCGGATGTCTGGGCTAT
CGGTGACGCAGCGACCTTTGAAGAGGCACCCTTACCAGCAACGGCTCAAGGTACCCGCTTTTTCAAGGATCGTTT
ATCTTAGTTAACCTATACCTCAGTCGCCTCCCAGAAAGCGCATTACATGATTACCAAACTTAATACTCTCGCGAA
GGATAAGGACCATTGTGAACCCTTCGAGTTCCATAACCAGGGCAGTCTGGCGTACATTGGGAACTGGTCAGGCGA
CTTACATATCCTGACGCTCGAACTCAGACTGATAATCATGTTAGGAATGCTATCTACGATCGTTCTTCGACACTT
CCGGAAGGAGAGAAGGACAAATTCATGTCGAAAGAAACAGGACGAGTAGCTTGGTTACTTTGGCGTTCCGCGTAC
TTTACTATGACGCTCAGTTGGAGGAACAAGTAAGTCCTGGATTGCTAAAGGTACAAGTTGCATACTCAACATGTT
TATTCCAGGATCTTGGTGCCAACTTACTGGTTTTTAAATTGTGAGTATCGATTGAGGTTTGATATTCGATCTCTT
CTGATTCACCACTTCAGGGATGTTTGGGAGAGACATGACTCGATTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail