Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115520
Gene name
Locationscaffold_9:497111..498428
Strand-
Gene length (bp)1317
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01575 MaoC_dehydratas MaoC like domain 2.0E-27 176 285

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VXJ0|DHB4_DROME Peroxisomal multifunctional enzyme type 2 OS=Drosophila melanogaster GN=Mfe2 PE=1 SV=1 20 311 4.0E-42
sp|Q54XZ0|MFEB_DICDI Probable enoyl-CoA hydratase 2 OS=Dictyostelium discoideum GN=mfeB PE=2 SV=1 1 304 9.0E-42
sp|P51659|DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3 9 303 6.0E-36
sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 2 303 4.0E-35
sp|P51660|DHB4_MOUSE Peroxisomal multifunctional enzyme type 2 OS=Mus musculus GN=Hsd17b4 PE=1 SV=3 9 303 8.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VXJ0|DHB4_DROME Peroxisomal multifunctional enzyme type 2 OS=Drosophila melanogaster GN=Mfe2 PE=1 SV=1 20 311 4.0E-42
sp|Q54XZ0|MFEB_DICDI Probable enoyl-CoA hydratase 2 OS=Dictyostelium discoideum GN=mfeB PE=2 SV=1 1 304 9.0E-42
sp|P51659|DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3 9 303 6.0E-36
sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 2 303 4.0E-35
sp|P51660|DHB4_MOUSE Peroxisomal multifunctional enzyme type 2 OS=Mus musculus GN=Hsd17b4 PE=1 SV=3 9 303 8.0E-34
sp|Q8VYI3|ECH2_ARATH Enoyl-CoA hydratase 2, peroxisomal OS=Arabidopsis thaliana GN=ECH2 PE=1 SV=1 8 298 2.0E-33
sp|Q01373|FOX2_NEUCR Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 3 301 8.0E-31
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 23 296 7.0E-23
sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=2 SV=1 13 273 3.0E-21
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115520
MSADLSKVVGFTLPDKPVAWTTRDLLLYAAGVGAKKDELHLAYELDKNFTPMPTYPVVLPLKGDSQEINLFSERV
KGRPVPGMPPMDPNRLVHGSQSIEIIKDIPLVSGPGWSWKSKYTGVSENKSGIVVVVENTLVSPTGEIYAKLYSS
SFNIGAKATGEKFNKSIAGPPNAKPIPKRSPDHTVPDATSPEQALVFRLSGDYNPLHIDPSIGERLGFGGVILHG
LSTFGFAARAIIKSVGNNDPKSLKFFGVRFTSPVKPGDKLETQAWEVGPGPEGTTEVTFITKNMTSGKVCIGGGI
AYVKKPSHAKL*
Coding >AgabiH97|115520
ATGTCTGCAGATCTTTCTAAAGTCGTTGGTTTCACTCTCCCGGACAAGCCTGTTGCTTGGACAACCCGCGACCTA
CTACTTTATGCCGCCGGTGTTGGTGCGAAGAAAGATGAACTTCACTTAGCCTATGAACTCGACAAAAACTTTACT
CCCATGCCCACATATCCTGTTGTCTTGCCTTTGAAGGGTGACAGTCAAGAAATTAACTTGTTTTCTGAGCGGGTC
AAGGGTAGACCTGTTCCTGGTATGCCTCCAATGGATCCTAATCGTCTGGTTCATGGTTCGCAATCTATTGAGATT
ATTAAGGATATACCTTTGGTTTCAGGACCTGGATGGTCGTGGAAATCAAAGTACACAGGCGTCAGCGAGAATAAG
TCTGGGATTGTTGTCGTTGTGGAGAATACACTGGTCAGTCCCACTGGTGAAATCTACGCGAAGCTCTACAGCTCG
TCGTTCAACATTGGGGCCAAGGCCACGGGTGAAAAATTCAACAAATCCATCGCCGGTCCACCCAACGCGAAACCC
ATTCCCAAGCGTTCTCCAGACCACACAGTACCTGACGCTACATCTCCCGAACAAGCCCTCGTCTTCCGTCTTAGC
GGAGACTACAACCCTCTACATATTGATCCTTCAATTGGAGAACGTCTTGGGTTTGGAGGTGTCATTCTTCATGGC
TTGTCAACCTTTGGGTTCGCTGCGAGAGCGATTATTAAATCTGTTGGAAATAATGACCCGAAGAGTTTGAAATTC
TTTGGTGTGAGGTTTACTAGTCCTGTTAAACCTGGTGATAAGCTTGAGACTCAAGCTTGGGAGGTTGGGCCTGGA
CCGGAGGGGACCACTGAGGTGACTTTTATCACCAAGAATATGACTAGTGGGAAGGTCTGTATCGGGGGTGGGATC
GCGTATGTTAAGAAACCTTCTCATGCTAAACTCTAA
Transcript >AgabiH97|115520
ATGTCTGCAGATCTTTCTAAAGTCGTTGGTTTCACTCTCCCGGACAAGCCTGTTGCTTGGACAACCCGCGACCTA
CTACTTTATGCCGCCGGTGTTGGTGCGAAGAAAGATGAACTTCACTTAGCCTATGAACTCGACAAAAACTTTACT
CCCATGCCCACATATCCTGTTGTCTTGCCTTTGAAGGGTGACAGTCAAGAAATTAACTTGTTTTCTGAGCGGGTC
AAGGGTAGACCTGTTCCTGGTATGCCTCCAATGGATCCTAATCGTCTGGTTCATGGTTCGCAATCTATTGAGATT
ATTAAGGATATACCTTTGGTTTCAGGACCTGGATGGTCGTGGAAATCAAAGTACACAGGCGTCAGCGAGAATAAG
TCTGGGATTGTTGTCGTTGTGGAGAATACACTGGTCAGTCCCACTGGTGAAATCTACGCGAAGCTCTACAGCTCG
TCGTTCAACATTGGGGCCAAGGCCACGGGTGAAAAATTCAACAAATCCATCGCCGGTCCACCCAACGCGAAACCC
ATTCCCAAGCGTTCTCCAGACCACACAGTACCTGACGCTACATCTCCCGAACAAGCCCTCGTCTTCCGTCTTAGC
GGAGACTACAACCCTCTACATATTGATCCTTCAATTGGAGAACGTCTTGGGTTTGGAGGTGTCATTCTTCATGGC
TTGTCAACCTTTGGGTTCGCTGCGAGAGCGATTATTAAATCTGTTGGAAATAATGACCCGAAGAGTTTGAAATTC
TTTGGTGTGAGGTTTACTAGTCCTGTTAAACCTGGTGATAAGCTTGAGACTCAAGCTTGGGAGGTTGGGCCTGGA
CCGGAGGGGACCACTGAGGTGACTTTTATCACCAAGAATATGACTAGTGGGAAGGTCTGTATCGGGGGTGGGATC
GCGTATGTTAAGAAACCTTCTCATGCTAAACTCTAA
Gene >AgabiH97|115520
ATGTCTGCAGATCTTTCTAAAGTCGTTGGTTTCACTCTCCCGGACAAGCCTGTATGCCCTGTAATTCGCACTATG
TGTCACCCAAGTTGACAATCAATTTCTAGGTTGCTTGGACAACCCGCGACCTACTACTTTATGCCGCCGGTGTTG
GTGCGAAGAAAGATGAACTTCACTTAGCCTATGGTGTGTACTGCTCTTCATGCTATGTAGAATCATCTAATTCTT
CTTCAAGAACTCGGTGAGAGCTTTAGGTCTTTCATAAGACCACAGATACTAAGCCAGCACATGCACAAAAGACAA
AAACTTTACTCCCATGCCCACATATCCTGTTGTCTTGCCTTTGAAGGGTGACAGTCAAGAAATTAACTTGTTTTC
TGAGCGGGTCAAGGGTAGACCTGTTCCTGGTATGCCTCCAATGGATCCTAATCGTCTGGTACGTGCTGGTTAGTC
AGGTGAATGACGTTAGTACTTACGAAGAGGCTTTTTCAGGTTCATGGTTCGCAATCTATTGAGATTATTAAGGAT
ATACCTTTGGTTTCAGGACCTGGATGGTCGTGGAAATCAAAGTACACAGGCGTCAGCGAGAATAGTATGTCTTTC
TGCATGTTTGGCGTGAACGTGGAATTTAACTGACATTGATTTCTTCTCGTACCAGAGTCTGGGATTGTTGTCGTT
GTGGAGAATACACTGGTCAGTCCCACTGGTGAAATCTACGCGAAGCTCTACGTATGTTATCCAAATTAACCCATT
CTCGACTTTCAATAACACCTTGGATAGAGCTCGTCGTTCAACATTGGGGCCAAGGCCACGGGTGAAAAATTCAAC
AAATCCATCGCCGGTCCACCCAACGCGAAACCCATTCCCAAGCGTTCTCCAGACCACACAGTACCTGACGCTACA
TCTCCCGAACAAGCCCTCGTCTTCCGTCTTAGCGGAGACTACAACCCTCTACATATTGATCCTTCAATTGGAGAA
CGTCTTGGGTTTGGAGGTGTCATTCTTCATGGCTTGTCAACCTTTGGGTTCGCTGCGAGAGCGATTATTAAATCT
GTTGGAAATAATGACCCGAAGAGTTTGAAATTCTTTGGTGTGAGGTTTACTAGTCCTGTTAAACCTGGTGATAAG
CTTGAGACTCAAGCTTGGGAGGTTGGGCCTGGACCGGAGGGGACCACTGAGGTGACTTTTATCACCAAGAATATG
ACTAGTGGGAAGGTAAGTCTTGGAGATACGGTTATTGTCCGAAAGTTGACGTTCTTTCAGGTCTGTATCGGGGGT
GGGATCGCGTATGTTAAGAAACCTTCTCATGCTAAACTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail