Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115480
Gene name
Locationscaffold_9:485018..487461
Strand+
Gene length (bp)2443
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00135 COesterase Carboxylesterase family 4.6E-88 18 464
PF20434 BD-FAE BD-FAE 4.4E-11 126 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32948|LIP4_CANRU Lipase 4 OS=Candida rugosa GN=LIP4 PE=3 SV=1 7 532 5.0E-140
sp|P20261|LIP1_CANRU Lipase 1 OS=Candida rugosa GN=LIP1 PE=1 SV=3 7 532 6.0E-139
sp|D4B1N9|LIP3_ARTBC Probable secreted lipase ARB_02369 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02369 PE=1 SV=1 17 536 2.0E-138
sp|P32947|LIP3_CANRU Lipase 3 OS=Candida rugosa GN=LIP3 PE=1 SV=1 7 533 7.0E-137
sp|P32946|LIP2_CANRU Lipase 2 OS=Candida rugosa GN=LIP2 PE=1 SV=1 27 532 3.0E-135
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32948|LIP4_CANRU Lipase 4 OS=Candida rugosa GN=LIP4 PE=3 SV=1 7 532 5.0E-140
sp|P20261|LIP1_CANRU Lipase 1 OS=Candida rugosa GN=LIP1 PE=1 SV=3 7 532 6.0E-139
sp|D4B1N9|LIP3_ARTBC Probable secreted lipase ARB_02369 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02369 PE=1 SV=1 17 536 2.0E-138
sp|P32947|LIP3_CANRU Lipase 3 OS=Candida rugosa GN=LIP3 PE=1 SV=1 7 533 7.0E-137
sp|P32946|LIP2_CANRU Lipase 2 OS=Candida rugosa GN=LIP2 PE=1 SV=1 27 532 3.0E-135
sp|P32949|LIP5_CANRU Lipase 5 OS=Candida rugosa GN=LIP5 PE=3 SV=1 7 503 1.0E-131
sp|P79066|LIP1_GEOFE Lipase 1 OS=Geotrichum fermentans GN=LIP1 PE=1 SV=1 14 527 2.0E-111
sp|P22394|LIP2_GEOCN Lipase 2 OS=Geotrichum candidum GN=LIP2 PE=1 SV=2 4 527 4.0E-111
sp|P17573|LIP1_GEOCN Lipase 1 OS=Geotrichum candidum GN=LIP1 PE=1 SV=2 8 508 4.0E-107
sp|P81908|CHLE_HORSE Cholinesterase OS=Equus caballus GN=BCHE PE=1 SV=1 33 354 3.0E-53
sp|P06276|CHLE_HUMAN Cholinesterase OS=Homo sapiens GN=BCHE PE=1 SV=1 33 476 5.0E-53
sp|P21927|CHLE_RABIT Cholinesterase OS=Oryctolagus cuniculus GN=BCHE PE=2 SV=1 33 509 4.0E-52
sp|Q03311|CHLE_MOUSE Cholinesterase OS=Mus musculus GN=Bche PE=1 SV=2 33 400 8.0E-52
sp|P32749|CHLE_BOVIN Cholinesterase OS=Bos taurus GN=BCHE PE=2 SV=2 33 354 9.0E-51
sp|O62760|CHLE_FELCA Cholinesterase OS=Felis catus GN=BCHE PE=2 SV=1 34 518 3.0E-50
sp|O62761|CHLE_PANTT Cholinesterase OS=Panthera tigris tigris GN=BCHE PE=2 SV=1 34 518 1.0E-49
sp|Q27459|ACE1_CAEBR Acetylcholinesterase 1 OS=Caenorhabditis briggsae GN=ace-1 PE=3 SV=1 6 502 2.0E-49
sp|P37967|PNBA_BACSU Para-nitrobenzyl esterase OS=Bacillus subtilis (strain 168) GN=pnbA PE=1 SV=2 28 515 5.0E-49
sp|P23795|ACES_BOVIN Acetylcholinesterase OS=Bos taurus GN=ACHE PE=1 SV=2 34 354 1.0E-48
sp|P22303|ACES_HUMAN Acetylcholinesterase OS=Homo sapiens GN=ACHE PE=1 SV=1 34 354 3.0E-48
sp|P37136|ACES_RAT Acetylcholinesterase OS=Rattus norvegicus GN=Ache PE=2 SV=1 34 502 4.0E-48
sp|O62763|ACES_FELCA Acetylcholinesterase OS=Felis catus GN=ACHE PE=3 SV=1 34 354 5.0E-48
sp|P07692|ACES_TORMA Acetylcholinesterase OS=Torpedo marmorata GN=ache PE=1 SV=2 33 506 6.0E-48
sp|P38433|ACE1_CAEEL Acetylcholinesterase 1 OS=Caenorhabditis elegans GN=ace-1 PE=1 SV=1 6 502 6.0E-48
sp|P21836|ACES_MOUSE Acetylcholinesterase OS=Mus musculus GN=Ache PE=1 SV=1 34 354 1.0E-47
sp|Q92035|ACES_BUNFA Acetylcholinesterase OS=Bungarus fasciatus GN=ACHE PE=1 SV=2 34 506 3.0E-47
sp|P04058|ACES_TORCA Acetylcholinesterase OS=Torpedo californica GN=ache PE=1 SV=2 33 506 3.0E-47
sp|Q29499|ACES_RABIT Acetylcholinesterase (Fragment) OS=Oryctolagus cuniculus GN=ACHE PE=2 SV=1 34 354 6.0E-47
sp|D4ASH1|LIP1_ARTBC Secreted lipase ARB07186/07185 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07185 PE=1 SV=2 27 464 4.0E-46
sp|Q86GC8|ACES_CULPI Acetylcholinesterase OS=Culex pipiens GN=ACHE1 PE=2 SV=2 22 503 8.0E-46
sp|Q8I034|EST5A_FELCA Carboxylesterase 5A OS=Felis catus GN=CES5A PE=1 SV=1 36 534 2.0E-44
sp|Q869C3|ACES_ANOGA Acetylcholinesterase OS=Anopheles gambiae GN=Ace PE=3 SV=3 22 503 4.0E-44
sp|Q8BK48|EST2E_MOUSE Pyrethroid hydrolase Ces2e OS=Mus musculus GN=Ces2e PE=1 SV=1 36 492 2.0E-43
sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 7 354 2.0E-42
sp|Q9DDE3|ACES_DANRE Acetylcholinesterase OS=Danio rerio GN=ache PE=3 SV=1 35 356 4.0E-42
sp|Q91WG0|EST2C_MOUSE Acylcarnitine hydrolase OS=Mus musculus GN=Ces2c PE=1 SV=1 31 492 1.0E-41
sp|Q8QZR3|EST2A_MOUSE Pyrethroid hydrolase Ces2a OS=Mus musculus GN=Ces2a PE=1 SV=1 31 498 1.0E-41
sp|Q6AW47|EST5A_CANLF Carboxylesterase 5A OS=Canis lupus familiaris GN=CES5A PE=2 SV=1 21 531 2.0E-41
sp|Q04791|SASB_ANAPL Fatty acyl-CoA hydrolase precursor, medium chain OS=Anas platyrhynchos PE=1 SV=1 21 348 2.0E-41
sp|Q27677|ACES_LEPDE Acetylcholinesterase OS=Leptinotarsa decemlineata PE=2 SV=1 12 510 3.0E-41
sp|P14943|EST2_RABIT Liver carboxylesterase 2 OS=Oryctolagus cuniculus GN=CES2 PE=1 SV=2 28 350 4.0E-41
sp|Q6NT32|EST5A_HUMAN Carboxylesterase 5A OS=Homo sapiens GN=CES5A PE=2 SV=1 36 420 6.0E-41
sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 7 354 6.0E-41
sp|O42275|ACES_ELEEL Acetylcholinesterase OS=Electrophorus electricus GN=ache PE=3 SV=1 35 354 1.0E-40
sp|P07140|ACES_DROME Acetylcholinesterase OS=Drosophila melanogaster GN=Ace PE=1 SV=1 12 510 2.0E-39
sp|Q5XG92|EST4A_HUMAN Carboxylesterase 4A OS=Homo sapiens GN=CES4A PE=2 SV=2 4 345 4.0E-39
sp|P56161|ACES_ANOST Acetylcholinesterase OS=Anopheles stephensi PE=3 SV=1 36 528 5.0E-39
sp|B2D0J5|EST6_APIME Venom carboxylesterase-6 OS=Apis mellifera PE=2 SV=1 25 351 2.0E-38
sp|O00748|EST2_HUMAN Cocaine esterase OS=Homo sapiens GN=CES2 PE=1 SV=1 28 504 2.0E-38
sp|Q8R0W5|EST4A_MOUSE Carboxylesterase 4A OS=Mus musculus GN=Ces4a PE=2 SV=2 36 508 1.0E-37
sp|Q64419|EST1_MESAU Liver carboxylesterase OS=Mesocricetus auratus PE=2 SV=1 36 350 1.0E-37
sp|P18142|D2_DICDI cAMP-regulated D2 protein OS=Dictyostelium discoideum GN=D2 PE=2 SV=3 39 510 1.0E-36
sp|P0C6R3|EST4A_BOVIN Carboxylesterase 4A OS=Bos taurus GN=CES4A PE=2 SV=1 14 345 1.0E-36
sp|Q63108|EST1E_RAT Carboxylesterase 1E OS=Rattus norvegicus GN=Ces1e PE=2 SV=1 1 504 2.0E-36
sp|Q64176|EST1E_MOUSE Carboxylesterase 1E OS=Mus musculus GN=Ces1e PE=1 SV=1 4 396 2.0E-36
sp|P23953|EST1C_MOUSE Carboxylesterase 1C OS=Mus musculus GN=Ces1c PE=1 SV=4 7 345 8.0E-36
sp|O46421|EST1_MACFA Liver carboxylesterase 1 OS=Macaca fascicularis GN=CES1 PE=2 SV=1 39 350 9.0E-36
sp|Q8VCU1|EST3B_MOUSE Carboxylesterase 3B OS=Mus musculus GN=Ces3b PE=1 SV=2 36 364 1.0E-35
sp|Q04457|EST1_CAEEL Gut esterase 1 OS=Caenorhabditis elegans GN=ges-1 PE=1 SV=1 2 445 1.0E-35
sp|P21837|CRYS_DICDI Crystal protein OS=Dictyostelium discoideum GN=cryS PE=1 SV=1 21 437 1.0E-35
sp|Q5GRG2|EST5A_RAT Carboxylesterase 5A OS=Rattus norvegicus GN=Ces5a PE=1 SV=1 36 350 2.0E-35
sp|Q9NDG8|ACE4_CAEBR Acetylcholinesterase 4 OS=Caenorhabditis briggsae GN=ace-4 PE=2 SV=1 6 359 2.0E-35
sp|Q8N2Q7|NLGN1_HUMAN Neuroligin-1 OS=Homo sapiens GN=NLGN1 PE=1 SV=2 34 535 2.0E-35
sp|Q63880|EST3A_MOUSE Carboxylesterase 3A OS=Mus musculus GN=Ces3a PE=1 SV=2 36 366 3.0E-35
sp|P23141|EST1_HUMAN Liver carboxylesterase 1 OS=Homo sapiens GN=CES1 PE=1 SV=2 2 345 4.0E-35
sp|Q8BYM5|NLGN3_MOUSE Neuroligin-3 OS=Mus musculus GN=Nlgn3 PE=1 SV=2 14 354 5.0E-35
sp|Q99K10|NLGN1_MOUSE Neuroligin-1 OS=Mus musculus GN=Nlgn1 PE=1 SV=2 34 535 5.0E-35
sp|Q95000|CHLE1_BRALA Cholinesterase 1 (Fragment) OS=Branchiostoma lanceolatum GN=CHE1 PE=3 SV=1 107 352 6.0E-35
sp|P16303|CES1D_RAT Carboxylesterase 1D OS=Rattus norvegicus GN=Ces1d PE=1 SV=2 4 345 6.0E-35
sp|Q29550|EST1_PIG Liver carboxylesterase OS=Sus scrofa PE=1 SV=1 33 345 7.0E-35
sp|P12337|EST1_RABIT Liver carboxylesterase 1 OS=Oryctolagus cuniculus PE=1 SV=3 39 345 7.0E-35
sp|Q62765|NLGN1_RAT Neuroligin-1 OS=Rattus norvegicus GN=Nlgn1 PE=1 SV=1 34 535 7.0E-35
sp|B0F2B4|NLGN4_MOUSE Neuroligin 4-like OS=Mus musculus GN=Nlgn4l PE=1 SV=1 26 354 9.0E-35
sp|Q8VCT4|CES1D_MOUSE Carboxylesterase 1D OS=Mus musculus GN=Ces1d PE=1 SV=1 36 345 2.0E-34
sp|Q6AW46|EST5A_MOUSE Carboxylesterase 5A OS=Mus musculus GN=Ces5a PE=2 SV=1 36 350 3.0E-34
sp|P36196|ACES_CHICK Acetylcholinesterase OS=Gallus gallus GN=ACHE PE=2 SV=1 29 328 3.0E-34
sp|Q64573|EST4_RAT Liver carboxylesterase 4 OS=Rattus norvegicus PE=2 SV=2 4 345 4.0E-34
sp|Q5RCL7|EST3_PONAB Carboxylesterase 3 OS=Pongo abelii GN=CES3 PE=2 SV=2 3 350 4.0E-34
sp|P25726|EST5B_DROPS Esterase-5B OS=Drosophila pseudoobscura pseudoobscura GN=Est-5B PE=2 SV=2 21 351 8.0E-34
sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 4 354 1.0E-33
sp|Q04456|EST1_CAEBR Gut esterase 1 OS=Caenorhabditis briggsae GN=ges-1 PE=2 SV=1 6 361 2.0E-33
sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 14 354 2.0E-33
sp|O16172|EST5B_DROPE Esterase-5B OS=Drosophila persimilis GN=Est-5B PE=3 SV=1 4 351 3.0E-33
sp|W4VSJ0|ACES_TRILK Acetylcholinesterase-1 OS=Trittame loki PE=1 SV=1 19 295 5.0E-33
sp|P47982|EST6_DROMA Esterase 6 OS=Drosophila mauritiana GN=Est-6 PE=3 SV=1 21 351 5.0E-33
sp|O16168|EST5A_DROMI Esterase-5A OS=Drosophila miranda GN=Est-5A PE=3 SV=1 21 351 5.0E-33
sp|P25727|EST5A_DROPS Esterase-5A OS=Drosophila pseudoobscura pseudoobscura GN=Est-5A PE=3 SV=3 21 351 1.0E-32
sp|O16169|EST5C_DROMI Esterase-5C OS=Drosophila miranda GN=Est-5C PE=3 SV=1 4 351 1.0E-32
sp|O16173|EST5A_DROPE Esterase-5A OS=Drosophila persimilis GN=Est-5A PE=3 SV=1 21 351 2.0E-32
sp|O16171|EST5C_DROPE Esterase-5C OS=Drosophila persimilis GN=Est-5C PE=3 SV=1 4 351 2.0E-32
sp|P08171|EST6_DROME Esterase-6 OS=Drosophila melanogaster GN=Est-6 PE=1 SV=2 21 351 2.0E-32
sp|P25725|EST5C_DROPS Esterase-5C OS=Drosophila pseudoobscura pseudoobscura GN=Est-5C PE=3 SV=1 4 351 3.0E-32
sp|Q6UWW8|EST3_HUMAN Carboxylesterase 3 OS=Homo sapiens GN=CES3 PE=1 SV=1 36 350 4.0E-32
sp|O16170|EST5B_DROMI Esterase-5B OS=Drosophila miranda GN=Est-5B PE=3 SV=1 21 351 5.0E-32
sp|Q63010|EST5_RAT Liver carboxylesterase B-1 OS=Rattus norvegicus PE=1 SV=1 4 345 7.0E-32
sp|Q08662|EST6_DROSI Esterase 6 OS=Drosophila simulans GN=Est-6 PE=3 SV=1 21 351 5.0E-31
sp|P30122|CEL_BOVIN Bile salt-activated lipase (Fragment) OS=Bos taurus GN=CEL PE=1 SV=2 39 508 6.0E-31
sp|P19835|CEL_HUMAN Bile salt-activated lipase OS=Homo sapiens GN=CEL PE=1 SV=3 1 504 9.0E-31
sp|D4AZ78|LIP2_ARTBC Secreted lipase ARB_01498 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01498 PE=1 SV=1 45 298 1.0E-30
sp|Q64285|CEL_MOUSE Bile salt-activated lipase OS=Mus musculus GN=Cel PE=1 SV=1 35 355 2.0E-30
sp|P86325|EST1_THEFU Carboxylesterase OS=Thermobifida fusca PE=1 SV=1 21 510 2.0E-30
sp|Q47M62|EST1_THEFY Carboxylesterase OS=Thermobifida fusca (strain YX) GN=Tfu_2427 PE=3 SV=1 21 510 2.0E-30
sp|P10959|EST1C_RAT Carboxylesterase 1C OS=Rattus norvegicus GN=Ces1c PE=1 SV=3 36 377 3.0E-30
sp|P07882|CEL_RAT Bile salt-activated lipase OS=Rattus norvegicus GN=Cel PE=1 SV=2 35 504 3.0E-30
sp|Q01470|PCD_ARTOX Phenmedipham hydrolase OS=Arthrobacter oxydans GN=pcd PE=1 SV=1 19 295 4.0E-30
sp|Q9UKY3|CES1P_HUMAN Putative inactive carboxylesterase 4 OS=Homo sapiens GN=CES1P1 PE=5 SV=2 36 264 9.0E-30
sp|P35501|ESTE_MYZPE Esterase E4 OS=Myzus persicae PE=1 SV=1 1 355 1.0E-29
sp|Q3T930|EST5A_SHEEP Carboxylesterase 5A (Fragment) OS=Ovis aries GN=CES5A PE=1 SV=1 110 350 1.0E-29
sp|P35502|ESTF_MYZPE Esterase FE4 OS=Myzus persicae PE=1 SV=1 1 355 1.0E-29
sp|P16854|EST1_CULPI Esterase B1 OS=Culex pipiens GN=B1 PE=3 SV=1 39 312 2.0E-29
sp|Q95001|CHLE2_BRALA Cholinesterase 2 (Fragment) OS=Branchiostoma lanceolatum GN=CHE2 PE=3 SV=1 131 356 2.0E-29
sp|Q5UR02|CHLE_MIMIV Probable cholinesterase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L906 PE=3 SV=1 36 309 3.0E-29
sp|Q07085|EST2_CAEEL Esterase CM06B1 OS=Caenorhabditis elegans GN=F13H6.3 PE=3 SV=3 36 538 3.0E-29
sp|Q8VCC2|EST1_MOUSE Liver carboxylesterase 1 OS=Mus musculus GN=Ces1 PE=1 SV=1 13 345 4.0E-29
sp|O08710|THYG_MOUSE Thyroglobulin OS=Mus musculus GN=Tg PE=1 SV=3 17 366 7.0E-29
sp|O94493|YC7C_SCHPO Uncharacterized esterase/lipase C417.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.12 PE=3 SV=2 26 295 8.0E-29
sp|P01266|THYG_HUMAN Thyroglobulin OS=Homo sapiens GN=TG PE=1 SV=5 26 351 9.0E-29
sp|Q92081|ACES_MYXGL Acetylcholinesterase (Fragment) OS=Myxine glutinosa GN=ache PE=3 SV=1 131 354 1.0E-28
sp|Q8NFZ4|NLGN2_HUMAN Neuroligin-2 OS=Homo sapiens GN=NLGN2 PE=1 SV=1 34 354 1.0E-28
sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 34 354 2.0E-28
sp|P01267|THYG_BOVIN Thyroglobulin OS=Bos taurus GN=TG PE=1 SV=1 26 366 5.0E-28
sp|P06882|THYG_RAT Thyroglobulin OS=Rattus norvegicus GN=Tg PE=1 SV=4 30 366 6.0E-28
sp|Q62888|NLGN2_RAT Neuroligin-2 OS=Rattus norvegicus GN=Nlgn2 PE=1 SV=1 34 354 8.0E-28
sp|D2D3B6|FUMD_SPHMC Fumonisin B1 esterase OS=Sphingopyxis macrogoltabida GN=fumD PE=1 SV=1 5 355 3.0E-27
sp|P32751|CHLE_MACMU Cholinesterase (Fragment) OS=Macaca mulatta GN=BCHE PE=2 SV=1 110 234 1.0E-26
sp|P32752|CHLE_PIG Cholinesterase (Fragment) OS=Sus scrofa GN=BCHE PE=2 SV=1 110 234 1.0E-26
sp|P32753|CHLE_SHEEP Cholinesterase (Fragment) OS=Ovis aries GN=BCHE PE=2 SV=1 110 234 5.0E-26
sp|Q96VC9|LIP3_YARLI Lipase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP3 PE=3 SV=1 26 253 2.0E-25
sp|P32750|CHLE_CANLF Cholinesterase (Fragment) OS=Canis lupus familiaris GN=BCHE PE=2 SV=1 110 234 1.0E-24
sp|P12992|ESTJ_HELVI Juvenile hormone esterase OS=Heliothis virescens PE=1 SV=2 39 369 1.0E-24
sp|P18167|ESTP_DROME Esterase P OS=Drosophila melanogaster GN=Est-P PE=2 SV=2 4 351 7.0E-24
sp|Q99156|LIP1_YARLI Lipase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP1 PE=3 SV=2 26 300 8.0E-22
sp|Q05487|ESTS_DROVI Esterase S OS=Drosophila virilis GN=EstS PE=2 SV=1 21 351 3.0E-21
sp|Q9XTG1|NLGN1_CAEEL Neuroligin-1 OS=Caenorhabditis elegans GN=nlg-1 PE=1 SV=1 21 329 7.0E-19
sp|P23654|NRT_DROME Neurotactin OS=Drosophila melanogaster GN=Nrt PE=1 SV=3 39 380 1.0E-16
sp|P33438|GLT_DROME Glutactin OS=Drosophila melanogaster GN=Glt PE=1 SV=2 36 371 2.0E-16
sp|P81429|EST1_SCHGA Esterase SG1 (Fragment) OS=Schizaphis graminum GN=SG1 PE=1 SV=1 4 210 3.0E-16
sp|Q86GC9|ACES_CULTO Acetylcholinesterase (Fragment) OS=Culex torrentium GN=ACE-1 PE=3 SV=1 32 177 4.0E-16
sp|Q867X2|ACES_CULQU Acetylcholinesterase (Fragment) OS=Culex quinquefasciatus GN=ACE-1 PE=3 SV=1 32 177 4.0E-16
sp|Q867X3|ACES_CULPP Acetylcholinesterase (Fragment) OS=Culex pipiens pipiens GN=ACE-1 PE=3 SV=1 32 177 4.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 17.03 8.90 25.16
Initials Initials knots 31.98 18.64 45.31
Pileal_Stipeal_center Stage I stipe center 14.48 7.73 21.22
Pileal_Stipeal_shell Stage I stipe shell 13.22 6.96 19.48
DIF_stipe_center Stage II stipe center 13.02 6.84 19.19
DIF_stipe_shell Stage II stipe shell 16.92 9.20 24.64
DIF_stipe_skin Stage II stipe skin 17.52 9.57 25.46
DIF_cap_skin Stage II cap skin 10.96 5.63 16.28
DIF_cap_tissue Stage II cap tissue 9.72 4.92 14.52
DIF_gill_tissue Stage II gill tissue 8.51 4.23 12.79
YFB_stipe_center Young fruiting body stipe center 14.07 7.38 20.76
YFB_stipe_shell Young fruiting body stipe shell 15.28 8.21 22.35
YFB_stipe_skin Young fruiting body stipe skin 19.23 10.65 27.81
YFB_cap_skin Young fruiting body cap skin 14.15 7.50 20.80
YFB_cap_tissue Young fruiting body cap tissue 12.48 6.53 18.43
YFB_gill_tissue Young fruiting body gill tissue 14.05 7.45 20.65
YFB_veil Young fruiting body veil 14.45 7.72 21.17

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.030851 yes
Casing YFB_stipe_center 0.684255 no
Casing YFB_stipe_shell 0.841337 no
Casing YFB_stipe_skin 0.811107 no
Casing YFB_cap_skin 0.704406 no
Casing YFB_cap_tissue 0.426625 no
Casing YFB_gill_tissue 0.683582 no
Casing YFB_veil 0.737901 no
Casing Initials 0.032978 yes
Casing Pileal_Stipeal_center 0.741726 no
Casing Pileal_Stipeal_shell 0.551896 no
Casing DIF_stipe_center 0.518570 no
Casing DIF_stipe_shell 0.991706 no
Casing DIF_stipe_skin 0.965513 no
Casing DIF_cap_skin 0.214129 no
Casing DIF_cap_tissue 0.083501 no
DIF_gill_tissue YFB_stipe_center 0.148649 no
DIF_gill_tissue YFB_stipe_shell 0.075734 no
DIF_gill_tissue YFB_stipe_skin 0.008791 yes
DIF_gill_tissue YFB_cap_skin 0.148649 no
DIF_gill_tissue YFB_cap_tissue 0.313977 no
DIF_gill_tissue YFB_gill_tissue 0.150303 no
DIF_gill_tissue YFB_veil 0.115655 no
YFB_stipe_center YFB_stipe_shell 0.884352 no
YFB_stipe_center YFB_stipe_skin 0.401877 no
YFB_stipe_center YFB_cap_skin 0.992605 no
YFB_stipe_center YFB_cap_tissue 0.825347 no
YFB_stipe_center YFB_gill_tissue 0.998003 no
YFB_stipe_center YFB_veil 0.966679 no
YFB_stipe_shell YFB_stipe_skin 0.574890 no
YFB_stipe_shell YFB_cap_skin 0.898822 no
YFB_stipe_shell YFB_cap_tissue 0.655687 no
YFB_stipe_shell YFB_gill_tissue 0.886259 no
YFB_stipe_shell YFB_veil 0.925513 no
YFB_stipe_skin YFB_cap_skin 0.438005 no
YFB_stipe_skin YFB_cap_tissue 0.204111 no
YFB_stipe_skin YFB_gill_tissue 0.415960 no
YFB_stipe_skin YFB_veil 0.462332 no
YFB_cap_skin YFB_cap_tissue 0.817269 no
YFB_cap_skin YFB_gill_tissue 0.991208 no
YFB_cap_skin YFB_veil 0.973534 no
YFB_cap_tissue YFB_gill_tissue 0.830387 no
YFB_cap_tissue YFB_veil 0.770660 no
YFB_gill_tissue YFB_veil 0.965027 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.002951 yes
Initials YFB_stipe_shell 0.009773 yes
Initials YFB_stipe_skin 0.084360 no
Initials YFB_cap_skin 0.003765 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.002525 yes
Initials YFB_veil 0.004928 yes
Initials Pileal_Stipeal_center 0.005302 yes
Initials Pileal_Stipeal_shell 0.002084 yes
Initials DIF_stipe_center 0.001625 yes
Initials DIF_stipe_shell 0.025963 yes
Initials DIF_stipe_skin 0.034837 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.116423 no
Pileal_Stipeal_center YFB_stipe_center 0.964449 no
Pileal_Stipeal_center YFB_stipe_shell 0.928122 no
Pileal_Stipeal_center YFB_stipe_skin 0.450517 no
Pileal_Stipeal_center YFB_cap_skin 0.970902 no
Pileal_Stipeal_center YFB_cap_tissue 0.767563 no
Pileal_Stipeal_center YFB_gill_tissue 0.962842 no
Pileal_Stipeal_center YFB_veil 0.996364 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.872437 no
Pileal_Stipeal_center DIF_stipe_center 0.846658 no
Pileal_Stipeal_center DIF_stipe_shell 0.748603 no
Pileal_Stipeal_center DIF_stipe_skin 0.667662 no
Pileal_Stipeal_center DIF_cap_skin 0.499171 no
Pileal_Stipeal_center DIF_cap_tissue 0.259790 no
Pileal_Stipeal_shell DIF_gill_tissue 0.225375 no
Pileal_Stipeal_shell YFB_stipe_center 0.920362 no
Pileal_Stipeal_shell YFB_stipe_shell 0.771915 no
Pileal_Stipeal_shell YFB_stipe_skin 0.286119 no
Pileal_Stipeal_shell YFB_cap_skin 0.914733 no
Pileal_Stipeal_shell YFB_cap_tissue 0.926658 no
Pileal_Stipeal_shell YFB_gill_tissue 0.923797 no
Pileal_Stipeal_shell YFB_veil 0.877975 no
Pileal_Stipeal_shell DIF_stipe_center 0.979951 no
Pileal_Stipeal_shell DIF_stipe_shell 0.554850 no
Pileal_Stipeal_shell DIF_stipe_skin 0.477926 no
Pileal_Stipeal_shell DIF_cap_skin 0.699718 no
Pileal_Stipeal_shell DIF_cap_tissue 0.440546 no
DIF_stipe_center DIF_gill_tissue 0.252405 no
DIF_stipe_center YFB_stipe_center 0.895893 no
DIF_stipe_center YFB_stipe_shell 0.742952 no
DIF_stipe_center YFB_stipe_skin 0.266240 no
DIF_stipe_center YFB_cap_skin 0.890093 no
DIF_stipe_center YFB_cap_tissue 0.947385 no
DIF_stipe_center YFB_gill_tissue 0.898345 no
DIF_stipe_center YFB_veil 0.850186 no
DIF_stipe_center DIF_stipe_shell 0.528044 no
DIF_stipe_center DIF_stipe_skin 0.451702 no
DIF_stipe_center DIF_cap_skin 0.735258 no
DIF_stipe_center DIF_cap_tissue 0.480000 no
DIF_stipe_shell DIF_gill_tissue 0.030610 yes
DIF_stipe_shell YFB_stipe_center 0.696249 no
DIF_stipe_shell YFB_stipe_shell 0.850733 no
DIF_stipe_shell YFB_stipe_skin 0.793252 no
DIF_stipe_shell YFB_cap_skin 0.715000 no
DIF_stipe_shell YFB_cap_tissue 0.438285 no
DIF_stipe_shell YFB_gill_tissue 0.693284 no
DIF_stipe_shell YFB_veil 0.746332 no
DIF_stipe_shell DIF_stipe_skin 0.954848 no
DIF_stipe_shell DIF_cap_skin 0.223370 no
DIF_stipe_shell DIF_cap_tissue 0.087080 no
DIF_stipe_skin DIF_gill_tissue 0.020260 yes
DIF_stipe_skin YFB_stipe_center 0.608244 no
DIF_stipe_skin YFB_stipe_shell 0.779200 no
DIF_stipe_skin YFB_stipe_skin 0.857317 no
DIF_stipe_skin YFB_cap_skin 0.632966 no
DIF_stipe_skin YFB_cap_tissue 0.354048 no
DIF_stipe_skin YFB_gill_tissue 0.610783 no
DIF_stipe_skin YFB_veil 0.663532 no
DIF_stipe_skin DIF_cap_skin 0.165674 no
DIF_stipe_skin DIF_cap_tissue 0.058542 no
DIF_cap_skin DIF_gill_tissue 0.577976 no
DIF_cap_skin YFB_stipe_center 0.568143 no
DIF_cap_skin YFB_stipe_shell 0.386183 no
DIF_cap_skin YFB_stipe_skin 0.089130 no
DIF_cap_skin YFB_cap_skin 0.566089 no
DIF_cap_skin YFB_cap_tissue 0.811040 no
DIF_cap_skin YFB_gill_tissue 0.574784 no
DIF_cap_skin YFB_veil 0.504520 no
DIF_cap_skin DIF_cap_tissue 0.831196 no
DIF_cap_tissue DIF_gill_tissue 0.813308 no
DIF_cap_tissue YFB_stipe_center 0.323787 no
DIF_cap_tissue YFB_stipe_shell 0.183815 no
DIF_cap_tissue YFB_stipe_skin 0.023415 yes
DIF_cap_tissue YFB_cap_skin 0.319976 no
DIF_cap_tissue YFB_cap_tissue 0.564693 no
DIF_cap_tissue YFB_gill_tissue 0.328972 no
DIF_cap_tissue YFB_veil 0.268970 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115480
MFRLFLLAFSAILVHAAAPTVKLDAATLTGNSAGNVHQFLGIPFTQPPVGDLRFRRPHPIQGYNQSFSATRYGRS
CPQQHFTAPILQGIPQDIASGVLNTLYTAAFPDGEDCLTINVIKPASAIPTSKLPVLVWIYGGAFEFGSTTQYDG
TGIVVKSIAMDSPVIFVSMNYRVSAFGFLAGKEVKEAGVGNLGLQDQREALRWVQKYIPAFGGDHTKVTIWGESA
GAISVSLHMLANGGNTGGLFRAAVMQSGAPIPVGDIERGQKYYNAIVDGTGCASANDTLQCLRTVPYAKLKAAVD
DTPNIFSYQSLHLAWLPRADGVFLTDHPQRLVQKGQIARVPFITGNCDDEGTAFSLSTLNVTENSQVADYFLNTF
LPGSLRPQILRLLNLYTENISEGSPFDTGILNALTPQFKRIAAILGDGVFQAPRRFFLNYTSGKQDIWVFLSKRF
KLLPFVGSLHGSDLLNSFLLGQELQDYIIRFTVTLDPNSKGLFGFKWPKYTTQDPKQLVFLDGLIPQVVGEDIYR
KEEMELLMQLTLDVPV*
Coding >AgabiH97|115480
ATGTTTCGGCTCTTCTTGCTTGCGTTTTCTGCGATACTCGTCCATGCTGCCGCTCCTACTGTCAAGCTCGATGCG
GCAACGTTGACTGGCAATTCTGCTGGTAATGTCCATCAATTCTTAGGTATACCGTTCACTCAGCCGCCTGTTGGT
GATCTACGCTTTCGTAGGCCTCATCCCATTCAGGGATATAATCAATCTTTTTCGGCGACTCGATACGGTCGATCA
TGCCCACAGCAGCATTTCACAGCTCCTATTCTCCAAGGCATTCCTCAAGATATTGCTTCCGGAGTACTCAACACT
CTTTATACCGCTGCGTTCCCTGACGGCGAAGACTGTCTTACGATCAACGTCATTAAACCCGCTTCGGCCATACCG
ACATCAAAATTGCCTGTCTTGGTGTGGATTTATGGAGGGGCATTCGAATTCGGCAGCACTACACAATACGATGGA
ACCGGTATTGTTGTGAAGTCCATAGCCATGGATTCACCTGTTATTTTCGTAAGCATGAATTATCGGGTCTCAGCT
TTCGGCTTTCTCGCAGGTAAGGAAGTCAAAGAGGCAGGTGTGGGCAATCTCGGCCTTCAAGATCAAAGGGAAGCT
CTACGATGGGTACAAAAATATATTCCCGCTTTCGGAGGAGATCATACGAAAGTGACAATTTGGGGAGAGTCTGCT
GGAGCTATATCGGTTTCTCTCCATATGTTGGCTAACGGGGGTAATACAGGGGGTCTGTTCCGCGCTGCAGTAATG
CAATCTGGAGCTCCCATTCCTGTCGGCGATATTGAGAGGGGTCAGAAGTATTACAATGCGATCGTCGATGGTACC
GGCTGCGCAAGCGCGAATGATACCTTGCAATGCTTACGCACAGTGCCGTATGCAAAATTGAAGGCAGCGGTTGAT
GATACTCCTAACATCTTTTCATACCAGTCATTACATTTGGCTTGGCTTCCTAGAGCAGATGGCGTATTCTTGACT
GATCATCCGCAGCGTCTCGTGCAAAAGGGACAAATTGCTCGTGTACCTTTCATCACTGGCAATTGTGACGATGAA
GGAACGGCTTTTTCCTTATCAACTTTGAACGTGACCGAAAACTCTCAAGTGGCCGACTACTTTTTGAATACCTTT
CTTCCTGGATCATTGCGTCCGCAGATCCTCAGACTTCTCAATTTGTACACTGAAAACATTTCGGAAGGATCGCCA
TTTGATACTGGCATATTGAATGCCTTGACACCTCAATTTAAACGCATTGCCGCCATTCTCGGTGACGGAGTATTC
CAGGCTCCTCGTCGTTTCTTCCTGAACTATACCTCTGGAAAACAGGATATCTGGGTATTTCTGAGCAAACGGTTT
AAATTACTTCCCTTTGTCGGCTCGTTACACGGCTCTGACTTGCTCAATTCGTTCCTTCTGGGACAAGAATTGCAA
GACTACATTATTCGATTCACTGTCACGTTGGATCCGAATAGCAAGGGGCTTTTCGGTTTCAAGTGGCCGAAGTAT
ACCACGCAGGACCCGAAGCAGCTTGTTTTTCTTGATGGTTTGATTCCTCAGGTTGTTGGTGAAGATATTTACCGT
AAGGAAGAGATGGAACTGTTGATGCAACTTACCTTGGATGTACCAGTGTGA
Transcript >AgabiH97|115480
ATGTTTCGGCTCTTCTTGCTTGCGTTTTCTGCGATACTCGTCCATGCTGCCGCTCCTACTGTCAAGCTCGATGCG
GCAACGTTGACTGGCAATTCTGCTGGTAATGTCCATCAATTCTTAGGTATACCGTTCACTCAGCCGCCTGTTGGT
GATCTACGCTTTCGTAGGCCTCATCCCATTCAGGGATATAATCAATCTTTTTCGGCGACTCGATACGGTCGATCA
TGCCCACAGCAGCATTTCACAGCTCCTATTCTCCAAGGCATTCCTCAAGATATTGCTTCCGGAGTACTCAACACT
CTTTATACCGCTGCGTTCCCTGACGGCGAAGACTGTCTTACGATCAACGTCATTAAACCCGCTTCGGCCATACCG
ACATCAAAATTGCCTGTCTTGGTGTGGATTTATGGAGGGGCATTCGAATTCGGCAGCACTACACAATACGATGGA
ACCGGTATTGTTGTGAAGTCCATAGCCATGGATTCACCTGTTATTTTCGTAAGCATGAATTATCGGGTCTCAGCT
TTCGGCTTTCTCGCAGGTAAGGAAGTCAAAGAGGCAGGTGTGGGCAATCTCGGCCTTCAAGATCAAAGGGAAGCT
CTACGATGGGTACAAAAATATATTCCCGCTTTCGGAGGAGATCATACGAAAGTGACAATTTGGGGAGAGTCTGCT
GGAGCTATATCGGTTTCTCTCCATATGTTGGCTAACGGGGGTAATACAGGGGGTCTGTTCCGCGCTGCAGTAATG
CAATCTGGAGCTCCCATTCCTGTCGGCGATATTGAGAGGGGTCAGAAGTATTACAATGCGATCGTCGATGGTACC
GGCTGCGCAAGCGCGAATGATACCTTGCAATGCTTACGCACAGTGCCGTATGCAAAATTGAAGGCAGCGGTTGAT
GATACTCCTAACATCTTTTCATACCAGTCATTACATTTGGCTTGGCTTCCTAGAGCAGATGGCGTATTCTTGACT
GATCATCCGCAGCGTCTCGTGCAAAAGGGACAAATTGCTCGTGTACCTTTCATCACTGGCAATTGTGACGATGAA
GGAACGGCTTTTTCCTTATCAACTTTGAACGTGACCGAAAACTCTCAAGTGGCCGACTACTTTTTGAATACCTTT
CTTCCTGGATCATTGCGTCCGCAGATCCTCAGACTTCTCAATTTGTACACTGAAAACATTTCGGAAGGATCGCCA
TTTGATACTGGCATATTGAATGCCTTGACACCTCAATTTAAACGCATTGCCGCCATTCTCGGTGACGGAGTATTC
CAGGCTCCTCGTCGTTTCTTCCTGAACTATACCTCTGGAAAACAGGATATCTGGGTATTTCTGAGCAAACGGTTT
AAATTACTTCCCTTTGTCGGCTCGTTACACGGCTCTGACTTGCTCAATTCGTTCCTTCTGGGACAAGAATTGCAA
GACTACATTATTCGATTCACTGTCACGTTGGATCCGAATAGCAAGGGGCTTTTCGGTTTCAAGTGGCCGAAGTAT
ACCACGCAGGACCCGAAGCAGCTTGTTTTTCTTGATGGTTTGATTCCTCAGGTTGTTGGTGAAGATATTTACCGT
AAGGAAGAGATGGAACTGTTGATGCAACTTACCTTGGATGTACCAGTGTGA
Gene >AgabiH97|115480
ATGTTTCGGCTCTTCTTGCTTGCGTTTTCTGCGATACTCGTCCATGCTGCCGCTCCTACTGTCAAGCTCGATGCG
GCAACGTTGACTGGCAATTCTGCTGGTAATGTCCATCAATTCTTAGGTATACCGTTCACTCAGCCGCCGTGAGTA
TTCCGTTCTGGTCCAGATGCATTACTAGTACTAATATCTCGTCGTAACGTAGTGTTGGTGATCTACGCTTTCGTA
GGCCTCATCCCATTCAGGGATATAATCAATCTTTTTCGGCGACTCGATACGGTCGATCATGCCCACAGCAGCATT
TCACAGCTCCTATTCTCCAAGGCATTCCTCAAGATATTGCTTCCGGAGTACTCAACACTCTTTATACCGCTGCGT
TCCCTGACGGCGAAGACTGTAAGCTATCTCACATATGTTGTAGCAGGAAGTCGACACCGTTGACCTGTAAATTAA
CAGGTCTTACGATCAACGTCATTAAACCCGCTTCGGCCATACCGACATCAAAATTGCCTGTCTTGGTGGTACGTT
TCAACGTGTTATTATAGGGGATTTGGACAGACAGTTGGCTAACTGAGTTATTGATGTTAACAGTGGATTTATGGA
GGTCCGTGATTCGTAGTTCTCCGACTCTGACTGCGTTCTTAAGTTGCATTTCAGGGGCATTCGAATTCGGCAGCA
CTACACAGTAAGAGCTTCATGTGTTGAATAATGACTATCGTTGTACTCAATATTAGTTGATATCCGATATCCAGA
TACGATGGAACCGGTATTGTTGTGAAGTCCATAGCCATGGATTCACCTGTTATTTTCGTAAGCATGAATTATCGG
TGAGCCCCTACCGAAAGCATGCTTGGTATCAAACGATCTCACGAAATTACTAGGGTCTCAGGTTAGTTGGTTATT
GTCCAACACTAGAACTTTGTGACTCAAGATGTTTAGCTTTCGGCTTTCTCGCAGGTAAGGAAGTCAAAGAGGCAG
GTGTGGGCAATCTCGGCCTTCAAGATCGTAAGTCTTTTTCAATCTTTTATATCATGGCCTTGACCGCTTGAAATT
TTCAGAAAGGGAAGCTCTACGATGGGTACAAAAATATATTCCCGCTTTCGGAGGAGATCATACGAAAGTGACAAT
GTGAGTGACGTATGCGATATCCTATAGTTAAACGATTCTAAAATTCACTCAAGTTGGGGAGAGTCTGCTGGAGCT
ATATCGGTTTCTCTCCATATGTTGGCTAACGGGGGTAATACAGGGGGTCTGTTCCGCGCTGCAGTAATGCAATCT
GGAGCTCCCATTCCTGTCGGCGATATTGAGAGGGGTCAGAAGTATTACAATGCGATCGTCGATGGTACCGGCTGC
GCAAGCGCGAATGATACCTTGCAATGCTTACGCACAGTGCCGTATGCAAAATTGAAGGCAGCGGTTGATGATACT
CCTAACATCTTTTCATACCAGGTAAATTTATGATGGGTGCTGAAGTGTAAACCCTTTGACTCACCGGTGAATGTT
TGTAGTCATTACATTTGGCTTGGCTTCCTAGAGCAGATGGCGTATTCTTGACTGATCATCCGCAGCGTCTCGTGC
AAAAGGGACAAATTGCTCGTGTACCTTTCATCACTGGTGTGCTTAATTCTCAAGCCTAGCACGTCTGACACCACT
AAAGGCTCACTGTAAACATGAATAGGCAATTGTGACGATGAAGGAACGGCTTTTTCCTTATCAACTTTGAACGTG
ACGTATGCAGTCTCTTTCCTTTATATGATCTGTAAAGTAATGGACCTCCTTTAAATCTAGCGAAAACTCTCAAGT
GGCCGACTACTTTTTGAATACCTTTCTTCCTGGATCATTGCGTCCGCAGATCCTCAGACTTCTCAATTTGTACAC
TGAAAACATTTCGGAAGGATCGCCATTTGATACTGGCATATTGAATGCCTTGACACCTCAATTTAAACGCATTGC
CGCCATTCTCGGTGACGGAGTATTCCAGGCTCCTCGTCGTTTCTTCCTGAACTATACCTCTGGAAAACAGGATAT
CTGGGTATTTCGTAAGTCTTGGTGTATTAATCTAACGCGGAGACCGCTGACATGTCAAACAGTGAGCAAACGGTT
TAAATTACTTCCCTTTGTCGGCTCGGTAAGTATTCACGAAAAAGGAGGGGGAAAAATACTAACATGCCCACTCCC
ATTTTTTCTTCTCCAGTTACACGGCTCTGACTTGCTCAATTCGTTCCTTCTGGGACAAGAATTGCAAGACTACAT
TATTCGATTCACTGTCACGTTGGATCCGAATAGCAAGGGGCTTTTCGGTTTCAAGTGGCCGAAGTATACCACGCA
GGACCCGAAGCAGCTTGTTTTTCTTGATGGTTTGATTCCTCAGGTTGTTGGTGAAGATATTTACCGTAAGGAAGA
GATGGAACTGTTGATGCAACTTACCTTGGATGTACCAGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail