Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115440
Gene name
Locationscaffold_9:479820..481675
Strand-
Gene length (bp)1855
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 7.0E-31 94 471
PF07687 M20_dimer Peptidase dimerisation domain 6.1E-11 211 367

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6I2|DUG1_SCHPO Cys-Gly metallodipeptidase dug1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dug1 PE=2 SV=2 11 474 0.0E+00
sp|Q96KP4|CNDP2_HUMAN Cytosolic non-specific dipeptidase OS=Homo sapiens GN=CNDP2 PE=1 SV=2 1 474 3.0E-178
sp|Q5R432|CNDP2_PONAB Cytosolic non-specific dipeptidase OS=Pongo abelii GN=CNDP2 PE=2 SV=1 1 474 7.0E-178
sp|Q5AKA5|DUG1_CANAL Cys-Gly metallodipeptidase DUG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DUG1 PE=1 SV=1 5 471 7.0E-177
sp|Q6Q0N1|CNDP2_RAT Cytosolic non-specific dipeptidase OS=Rattus norvegicus GN=Cndp2 PE=1 SV=1 1 474 1.0E-176
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6I2|DUG1_SCHPO Cys-Gly metallodipeptidase dug1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dug1 PE=2 SV=2 11 474 0.0E+00
sp|Q96KP4|CNDP2_HUMAN Cytosolic non-specific dipeptidase OS=Homo sapiens GN=CNDP2 PE=1 SV=2 1 474 3.0E-178
sp|Q5R432|CNDP2_PONAB Cytosolic non-specific dipeptidase OS=Pongo abelii GN=CNDP2 PE=2 SV=1 1 474 7.0E-178
sp|Q5AKA5|DUG1_CANAL Cys-Gly metallodipeptidase DUG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DUG1 PE=1 SV=1 5 471 7.0E-177
sp|Q6Q0N1|CNDP2_RAT Cytosolic non-specific dipeptidase OS=Rattus norvegicus GN=Cndp2 PE=1 SV=1 1 474 1.0E-176
sp|Q9D1A2|CNDP2_MOUSE Cytosolic non-specific dipeptidase OS=Mus musculus GN=Cndp2 PE=1 SV=1 1 474 4.0E-176
sp|Q3ZC84|CNDP2_BOVIN Cytosolic non-specific dipeptidase OS=Bos taurus GN=CNDP2 PE=2 SV=1 1 474 1.0E-175
sp|P43616|DUG1_YEAST Cys-Gly metallodipeptidase DUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG1 PE=1 SV=1 11 470 1.0E-164
sp|Q66HG3|CNDP1_RAT Beta-Ala-His dipeptidase OS=Rattus norvegicus GN=Cndp1 PE=1 SV=1 5 474 3.0E-136
sp|Q96KN2|CNDP1_HUMAN Beta-Ala-His dipeptidase OS=Homo sapiens GN=CNDP1 PE=1 SV=4 5 474 9.0E-135
sp|Q8BUG2|CNDP1_MOUSE Beta-Ala-His dipeptidase OS=Mus musculus GN=Cndp1 PE=2 SV=1 5 474 4.0E-133
sp|P38149|DUG2_YEAST Probable di- and tripeptidase DUG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG2 PE=1 SV=1 16 467 3.0E-50
sp|Q8NVL7|DAPE_STAAW Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MW2) GN=dapE PE=3 SV=1 19 234 2.0E-06
sp|Q6G7T6|DAPE_STAAS Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MSSA476) GN=dapE PE=3 SV=1 19 234 2.0E-06
sp|Q99SN6|DAPE_STAAN Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain N315) GN=dapE PE=1 SV=1 19 234 3.0E-06
sp|Q931I4|DAPE_STAAM Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dapE PE=3 SV=1 19 234 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115440
MPAPQEFIKYIDDKADAFIQRLSDAVAIPSVSSDASRRQDVIKMANWLSEQLQAVGVTTQLTDLGKQQIEGQELP
LPPVILGKIGNDKNKKTILVYGHFDVQPAFKSDGWDTDPFTLVNDKATGRLIGRGASDDKGPVLGWVNVLQWHHE
NKKELPVNLRCCFEGMEESGSEGLDDLVARESKPGGWFDGVDAVCISDNYWLNTRTPALTYGLRGLSYYRVTVSG
PARDLHSGVFGRTVYEPMTDLIYIMSKLVDNRGHILIPGVEDQVGIADEEEKKIYQALDYSIQDVEESAGAPIAL
SSDKVEVLMGRMRNPSLSLHGIEGAFSGVGAKTVIPAKVSGKFSIRLVPPQTPESVDPFVISYIEELFKGLHSKS
KLEVESLHGGKPWVADHNHWNYEAAKRATWSTYNRLPDLTREGGSIPVTLTFADCLGVNVVLLPMGRGDDGAHST
NEKIDRFNFIEGTKLLGSYLYEVAV*
Coding >AgabiH97|115440
ATGCCTGCTCCCCAAGAGTTCATCAAATACATCGATGATAAGGCCGATGCTTTCATCCAACGTCTCTCGGATGCC
GTTGCAATCCCGAGTGTTAGCAGTGATGCTTCACGCCGCCAAGATGTCATCAAAATGGCTAATTGGTTGAGCGAA
CAACTCCAAGCTGTCGGTGTTACTACTCAACTCACAGACCTTGGAAAACAGCAAATAGAAGGACAAGAGCTTCCT
CTTCCACCTGTTATCCTGGGAAAGATTGGAAATGACAAAAACAAGAAGACGATTCTTGTGTATGGTCACTTTGAT
GTTCAGCCTGCTTTCAAAAGCGATGGTTGGGACACGGATCCATTCACGTTGGTGAACGACAAGGCGACCGGTCGT
CTAATCGGACGTGGCGCCTCGGACGATAAGGGCCCTGTTCTCGGATGGGTCAATGTATTGCAATGGCACCACGAA
AATAAAAAAGAACTCCCCGTTAACCTTAGGTGCTGTTTCGAAGGGATGGAGGAGAGCGGTAGTGAGGGACTCGAT
GACCTTGTCGCCAGAGAGAGTAAGCCTGGAGGTTGGTTTGACGGTGTGGACGCTGTCTGCATTTCTGACAACTAC
TGGTTGAACACCAGGACGCCTGCGCTCACCTATGGACTTCGTGGATTGTCATACTACAGAGTCACTGTCTCTGGC
CCCGCACGCGACCTGCATTCAGGAGTGTTTGGTCGCACCGTTTATGAGCCAATGACCGATCTTATCTATATCATG
AGCAAACTCGTTGATAATCGTGGCCATATTCTCATTCCTGGAGTTGAAGATCAAGTCGGCATCGCGGACGAAGAG
GAAAAGAAGATCTACCAGGCTCTCGACTATTCGATCCAAGACGTAGAGGAGTCGGCGGGTGCTCCCATTGCCCTG
TCTTCCGATAAAGTCGAGGTGCTGATGGGAAGGATGCGGAACCCTAGCTTATCCTTGCATGGCATCGAGGGAGCA
TTCAGCGGCGTAGGTGCTAAGACCGTCATCCCCGCCAAAGTATCAGGTAAATTTAGCATTCGGCTCGTTCCTCCC
CAAACGCCAGAGTCCGTCGACCCATTCGTCATTTCATACATTGAGGAGCTATTCAAGGGGCTTCATTCGAAGAGC
AAGCTCGAGGTTGAGAGCTTGCATGGCGGCAAACCATGGGTAGCCGATCACAACCATTGGAATTATGAAGCTGCG
AAAAGAGCTACTTGGAGCACCTATAACAGACTTCCGGACTTGACAAGGGAGGGAGGCTCTATTCCTGTCACACTC
ACATTTGCAGACTGTTTGGGAGTAAATGTTGTGTTGTTGCCAATGGGGCGGGGTGACGACGGTGCACATTCGACG
AACGAGAAAATCGATAGATTTAATTTCATTGAAGGAACCAAATTGTTGGGATCGTATCTATACGAAGTTGCCGTG
TAA
Transcript >AgabiH97|115440
ATGCCTGCTCCCCAAGAGTTCATCAAATACATCGATGATAAGGCCGATGCTTTCATCCAACGTCTCTCGGATGCC
GTTGCAATCCCGAGTGTTAGCAGTGATGCTTCACGCCGCCAAGATGTCATCAAAATGGCTAATTGGTTGAGCGAA
CAACTCCAAGCTGTCGGTGTTACTACTCAACTCACAGACCTTGGAAAACAGCAAATAGAAGGACAAGAGCTTCCT
CTTCCACCTGTTATCCTGGGAAAGATTGGAAATGACAAAAACAAGAAGACGATTCTTGTGTATGGTCACTTTGAT
GTTCAGCCTGCTTTCAAAAGCGATGGTTGGGACACGGATCCATTCACGTTGGTGAACGACAAGGCGACCGGTCGT
CTAATCGGACGTGGCGCCTCGGACGATAAGGGCCCTGTTCTCGGATGGGTCAATGTATTGCAATGGCACCACGAA
AATAAAAAAGAACTCCCCGTTAACCTTAGGTGCTGTTTCGAAGGGATGGAGGAGAGCGGTAGTGAGGGACTCGAT
GACCTTGTCGCCAGAGAGAGTAAGCCTGGAGGTTGGTTTGACGGTGTGGACGCTGTCTGCATTTCTGACAACTAC
TGGTTGAACACCAGGACGCCTGCGCTCACCTATGGACTTCGTGGATTGTCATACTACAGAGTCACTGTCTCTGGC
CCCGCACGCGACCTGCATTCAGGAGTGTTTGGTCGCACCGTTTATGAGCCAATGACCGATCTTATCTATATCATG
AGCAAACTCGTTGATAATCGTGGCCATATTCTCATTCCTGGAGTTGAAGATCAAGTCGGCATCGCGGACGAAGAG
GAAAAGAAGATCTACCAGGCTCTCGACTATTCGATCCAAGACGTAGAGGAGTCGGCGGGTGCTCCCATTGCCCTG
TCTTCCGATAAAGTCGAGGTGCTGATGGGAAGGATGCGGAACCCTAGCTTATCCTTGCATGGCATCGAGGGAGCA
TTCAGCGGCGTAGGTGCTAAGACCGTCATCCCCGCCAAAGTATCAGGTAAATTTAGCATTCGGCTCGTTCCTCCC
CAAACGCCAGAGTCCGTCGACCCATTCGTCATTTCATACATTGAGGAGCTATTCAAGGGGCTTCATTCGAAGAGC
AAGCTCGAGGTTGAGAGCTTGCATGGCGGCAAACCATGGGTAGCCGATCACAACCATTGGAATTATGAAGCTGCG
AAAAGAGCTACTTGGAGCACCTATAACAGACTTCCGGACTTGACAAGGGAGGGAGGCTCTATTCCTGTCACACTC
ACATTTGCAGACTGTTTGGGAGTAAATGTTGTGTTGTTGCCAATGGGGCGGGGTGACGACGGTGCACATTCGACG
AACGAGAAAATCGATAGATTTAATTTCATTGAAGGAACCAAATTGTTGGGATCGTATCTATACGAAGTTGCCGTG
TAA
Gene >AgabiH97|115440
ATGCCTGCTCCCCAAGAGTTCATCAAATACATCGATGATAAGGCCGATGCTTTCATCCAACGTCTCTCGGATGCC
GTTGCAATCCCGAGGTAATCATCATTCTGATATCCACAATACAGCATCACGATCATTGATATCACCCTTCCATTC
AGTGTTAGCAGTGATGCTTCACGCCGCCAAGATGTCATCAAAATGGCTAATTGGTTGAGCGAACAACTCCAAGCT
GTCGGTGTTACTACTCAACTCACAGACCTTGGAAAACAGCAAATAGAAGGACAAGAGCTTCCTCTTCCACCTGTT
ATCCTGGGAAAGATTGGAAATGACAAAAACAAGAAGACGATTCTTGTGTATGGTCACTTTGATGTTCAGCCTGTC
AGCATGATCAATTTGTCTGCCCTTCGATATATTGATCGATGTTACGAAAGGCTTTCAAAAGCGATGGTTGGGACA
CGGATCCATTCACGTTGGTGAACGACAAGGCGACCGGTCGTCTAATCGGACGTGGCGCCTCGGACGATAAGGGCC
CTGTTCTCGGATGGGTCAATGTATTGCAATGGCACCACGAAAATAAAAAAGAACTCCCCGTTAACCTTAGGTGCT
GTTTCGAAGGGATGGAGGAGAGCGGTAGTGAGGGACTCGATGACCTTGTCGCCAGAGAGAGTAAGCCTGGAGGTT
GGTTTGACGGTGTGGACGCTGTCTGCATTGTGTGTATGGTTTCGAGGCTTTTTGTCTGTGGCTGACTTGTGCCTG
TAGTCTGACAACTACTGGTTGAACACCAGGACGCCTGCGCTCACCTATGGACTTCGTGGATTGTCATACTACAGA
GTCACTGTCTCTGGCCCCGCACGCGACCTGCATTCAGGAGTGTTTGGTCGCACCGTTTATGAGCCAATGACCGAT
CTTATCTATATCATGAGCAAACTCGTTGATAATCGTGGCCATATTCTCATTCCTGGAGTTGAAGATCAAGTCGGC
ATCGCGGACGAAGAGGAAAAGTTCGTTGGTTCAATTTGGGTGTGCGGGCTGGAAGGTATTTACTGTGACATATAG
GAAGATCTACCAGGCTCTCGACTATTCGATCCAAGACGTAGAGGAGTCGGCGGGTGCTCCCATTGCCCTGTCTTC
CGATAAAGTCGAGGTGCTGATGGGAAGGATGCGGAACCCTAGCTTATCCTTGCATGGCATCGAGGGAGCATTCAG
CGGCGTAGGTGCTAAGACCGTCATCCCCGCCAAAGTATCAGGTAAATTTAGCATTCGGTTAGTCATTTCTCCGAT
AATTTTGAGTCTAGTATCTGAAATCATAACAGGCTCGTTCCTCCCCAAACGCCAGAGTCCGTCGACCCATTCGTC
ATTTCATACATTGAGGAGCTATTCAAGGGGCTTCATTCGAAGAGCAAGCTCGAGGTTGAGAGCTTGCATGGCGGC
AAACCATGGGTAGCCGATCACAACCATTGGAATTATGAAGCTGCGAAAAGAGCTACTTGGGCAAGTCGTTCTAGA
GCTCGTAGCTTCAAAATACCTCTGATCGCGTTGAACAGAGCACCTATAACAGACTTCCGGACTTGACAAGGGAGG
GAGGCTCTATTCCTGTCACACTCACATTTGCAGACTGTTTGGGAGTAAATGTTGTGTTGTTGCCAATGGGGCGGG
GTGACGACGGTGCACAGTGAGTTTAAGGTCCTCTAGCCATAATCGTCGCATATACTGACGTTGTGTAGTTCGACG
AACGAGAAAATCGATAGATTTAATTTCATTGAAGGAGTAAGTGATAGTCGCCACAGCGGACCGATTCCTTTAGTT
GACATCCGTCTAGACCAAATTGTTGGGATCGTATCTATACGAAGTTGCCGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail