Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115350
Gene name
Locationscaffold_9:453258..456791
Strand+
Gene length (bp)3533
Transcript length (bp)3144
Coding sequence length (bp)3144
Protein length (aa) 1048

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00155 Aminotran_1_2 Aminotransferase class I and II 1.7E-41 605 854
PF00155 Aminotran_1_2 Aminotransferase class I and II 7.8E-09 917 1012
PF15916 DUF4743 Domain of unknown function (DUF4743) 4.9E-06 95 177
PF00293 NUDIX NUDIX domain 6.8E-05 198 316

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09925|LCB2_SCHPO Serine palmitoyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcb2 PE=3 SV=1 471 1045 0.0E+00
sp|P40970|LCB2_YEAST Serine palmitoyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB2 PE=1 SV=1 483 1043 0.0E+00
sp|P48241|LCB2_KLULA Serine palmitoyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LCB2 PE=3 SV=2 457 1040 1.0E-180
sp|P97363|SPTC2_MOUSE Serine palmitoyltransferase 2 OS=Mus musculus GN=Sptlc2 PE=1 SV=2 476 1024 1.0E-157
sp|O54694|SPTC2_CRIGR Serine palmitoyltransferase 2 OS=Cricetulus griseus GN=SPTLC2 PE=2 SV=1 499 1028 3.0E-156
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09925|LCB2_SCHPO Serine palmitoyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcb2 PE=3 SV=1 471 1045 0.0E+00
sp|P40970|LCB2_YEAST Serine palmitoyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB2 PE=1 SV=1 483 1043 0.0E+00
sp|P48241|LCB2_KLULA Serine palmitoyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LCB2 PE=3 SV=2 457 1040 1.0E-180
sp|P97363|SPTC2_MOUSE Serine palmitoyltransferase 2 OS=Mus musculus GN=Sptlc2 PE=1 SV=2 476 1024 1.0E-157
sp|O54694|SPTC2_CRIGR Serine palmitoyltransferase 2 OS=Cricetulus griseus GN=SPTLC2 PE=2 SV=1 499 1028 3.0E-156
sp|O15270|SPTC2_HUMAN Serine palmitoyltransferase 2 OS=Homo sapiens GN=SPTLC2 PE=1 SV=1 502 1024 8.0E-155
sp|Q9NUV7|SPTC3_HUMAN Serine palmitoyltransferase 3 OS=Homo sapiens GN=SPTLC3 PE=1 SV=3 502 1031 8.0E-148
sp|Q54EX5|SPTC2_DICDI Serine palmitoyltransferase 2 OS=Dictyostelium discoideum GN=sptB PE=1 SV=1 502 1023 9.0E-142
sp|Q20375|SPTC2_CAEEL Serine palmitoyltransferase 2 OS=Caenorhabditis elegans GN=sptl-2 PE=3 SV=1 511 1019 2.0E-133
sp|Q2R3K3|LCB2A_ORYSJ Long chain base biosynthesis protein 2a OS=Oryza sativa subsp. japonica GN=Os11g0516000 PE=2 SV=1 504 1024 1.0E-130
sp|Q5JK39|LCB2D_ORYSJ Long chain base biosynthesis protein 2d OS=Oryza sativa subsp. japonica GN=Os01g0928800 PE=2 SV=1 504 1024 1.0E-128
sp|Q8BG54|SPTC3_MOUSE Serine palmitoyltransferase 3 OS=Mus musculus GN=Sptlc3 PE=2 SV=1 501 1031 4.0E-126
sp|Q9LSZ9|LCB2A_ARATH Long chain base biosynthesis protein 2a OS=Arabidopsis thaliana GN=LCB2a PE=1 SV=1 504 1024 7.0E-123
sp|Q9M304|LCB2B_ARATH Long chain base biosynthesis protein 2b OS=Arabidopsis thaliana GN=LCB2b PE=1 SV=1 504 1024 1.0E-122
sp|Q8RYL0|LCB2C_ORYSJ Long chain base biosynthesis protein 2c OS=Oryza sativa subsp. japonica GN=Os01g0928700 PE=3 SV=1 504 1024 5.0E-122
sp|Q8RYL1|LCB2B_ORYSJ Long chain base biosynthesis protein 2b OS=Oryza sativa subsp. japonica GN=Os01g0928600 PE=2 SV=1 504 1024 5.0E-119
sp|Q9XVI6|SPTC3_CAEEL Serine palmitoyltransferase 3 OS=Caenorhabditis elegans GN=sptl-3 PE=3 SV=2 544 1017 3.0E-115
sp|A6LMP4|BIOF_THEM4 8-amino-7-oxononanoate synthase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=Tmel_1346 PE=3 SV=1 603 1020 2.0E-60
sp|B7ID58|BIOF_THEAB 8-amino-7-oxononanoate synthase OS=Thermosipho africanus (strain TCF52B) GN=THA_1494 PE=3 SV=1 596 1020 2.0E-60
sp|B0K590|BIOF_THEPX 8-amino-7-oxononanoate synthase OS=Thermoanaerobacter sp. (strain X514) GN=Teth514_0779 PE=3 SV=1 603 1022 3.0E-57
sp|B0KC20|BIOF_THEP3 8-amino-7-oxononanoate synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=Teth39_0287 PE=3 SV=1 605 1022 5.0E-57
sp|A6TU88|BIOF_ALKMQ 8-amino-7-oxononanoate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=Amet_3634 PE=3 SV=1 600 1022 6.0E-56
sp|Q73KM3|BIOF_TREDE 8-amino-7-oxononanoate synthase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_2194 PE=3 SV=1 600 1017 9.0E-56
sp|A7HMM1|BIOF_FERNB 8-amino-7-oxononanoate synthase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=Fnod_1307 PE=3 SV=1 600 1017 5.0E-55
sp|Q67N86|BIOF_SYMTH 8-amino-7-oxononanoate synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=STH1872 PE=3 SV=1 605 1022 5.0E-54
sp|A8MEX7|BIOF_ALKOO 8-amino-7-oxononanoate synthase OS=Alkaliphilus oremlandii (strain OhILAs) GN=Clos_0909 PE=3 SV=1 600 1022 2.0E-52
sp|Q5HIC5|PPAT_STAAC Putative pyridoxal phosphate-dependent acyltransferase OS=Staphylococcus aureus (strain COL) GN=SACOL0596 PE=3 SV=1 600 1022 3.0E-52
sp|Q8NXY3|PPAT_STAAW Putative pyridoxal phosphate-dependent acyltransferase OS=Staphylococcus aureus (strain MW2) GN=MW0505 PE=3 SV=1 600 1022 4.0E-52
sp|Q6GBT7|PPAT_STAAS Putative pyridoxal phosphate-dependent acyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0508 PE=3 SV=1 600 1022 4.0E-52
sp|P60120|PPAT_STAAN Putative pyridoxal phosphate-dependent acyltransferase OS=Staphylococcus aureus (strain N315) GN=SA0508 PE=1 SV=1 600 1022 4.0E-52
sp|P60121|PPAT_STAAM Putative pyridoxal phosphate-dependent acyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0550 PE=3 SV=1 600 1022 4.0E-52
sp|B5Y9Z4|BIOF_COPPD 8-amino-7-oxononanoate synthase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=COPRO5265_1289 PE=3 SV=2 603 1020 7.0E-49
sp|Q5KY23|BIOF_GEOKA Putative 8-amino-7-oxononanoate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=bioF PE=3 SV=1 605 1010 7.0E-48
sp|A7GSE1|BIOF_BACCN Putative 8-amino-7-oxononanoate synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=bioF PE=3 SV=1 596 1017 8.0E-48
sp|P47173|YJ9J_YEAST Uncharacterized protein YJR142W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR142W PE=1 SV=1 120 358 8.0E-48
sp|Q8EM07|PPAT_OCEIH Putative pyridoxal phosphate-dependent acyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB3054 PE=3 SV=1 603 1022 2.0E-47
sp|O31777|BIOF1_BACSU 8-amino-7-oxononanoate synthase 1 OS=Bacillus subtilis (strain 168) GN=kbl PE=3 SV=1 598 849 9.0E-47
sp|B1YMC6|BIOF_EXIS2 8-amino-7-oxononanoate synthase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=Exig_1033 PE=3 SV=1 561 1022 1.0E-46
sp|A7Z4X1|BIOF1_BACMF 8-amino-7-oxononanoate synthase 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=RBAM_016840 PE=3 SV=1 605 1013 2.0E-45
sp|A9BGL0|BIOF_PETMO 8-amino-7-oxononanoate synthase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=Pmob_1549 PE=3 SV=1 600 847 1.0E-44
sp|Q5R9T5|SPTC1_PONAB Serine palmitoyltransferase 1 OS=Pongo abelii GN=SPTLC1 PE=2 SV=1 600 847 4.0E-44
sp|Q60HD1|SPTC1_MACFA Serine palmitoyltransferase 1 OS=Macaca fascicularis GN=SPTLC1 PE=2 SV=1 600 847 4.0E-44
sp|O15269|SPTC1_HUMAN Serine palmitoyltransferase 1 OS=Homo sapiens GN=SPTLC1 PE=1 SV=1 600 847 5.0E-44
sp|Q749W3|BIOF_GEOSL 8-amino-7-oxononanoate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=bioF PE=3 SV=1 607 847 5.0E-44
sp|Q3MHG1|SPTC1_BOVIN Serine palmitoyltransferase 1 OS=Bos taurus GN=SPTLC1 PE=2 SV=1 600 847 2.0E-43
sp|Q65ML1|BIOF_BACLD Putative 8-amino-7-oxononanoate synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=bioF PE=3 SV=1 606 880 2.0E-43
sp|Q9K625|BIOF_BACHD Putative 8-amino-7-oxononanoate synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bioF PE=3 SV=1 596 1007 3.0E-43
sp|A3DBD5|BIOF_CLOTH Putative 8-amino-7-oxononanoate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=bioF PE=3 SV=1 603 1022 5.0E-43
sp|O54695|SPTC1_CRIGR Serine palmitoyltransferase 1 OS=Cricetulus griseus GN=SPTLC1 PE=1 SV=1 594 847 4.0E-42
sp|O35704|SPTC1_MOUSE Serine palmitoyltransferase 1 OS=Mus musculus GN=Sptlc1 PE=1 SV=2 594 847 7.0E-42
sp|B7GHW7|BIOF_ANOFW Putative 8-amino-7-oxononanoate synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=bioF PE=3 SV=1 605 1022 3.0E-41
sp|O59682|LCB1_SCHPO Serine palmitoyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcb1 PE=3 SV=1 606 861 4.0E-41
sp|Q81V80|PPAT_BACAN Putative pyridoxal phosphate-dependent acyltransferase OS=Bacillus anthracis GN=BA_0620 PE=3 SV=1 605 1017 4.0E-41
sp|Q731H9|BIOF_BACC1 Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=bioF PE=3 SV=1 596 1017 6.0E-41
sp|Q6GJB8|PPAT_STAAR Putative pyridoxal phosphate-dependent acyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0555 PE=3 SV=1 600 861 9.0E-41
sp|P91079|SPTC1_CAEEL Serine palmitoyltransferase 1 OS=Caenorhabditis elegans GN=sptl-1 PE=3 SV=1 603 860 1.0E-40
sp|Q6K8E7|LCB1B_ORYSJ Long chain base biosynthesis protein 1b OS=Oryza sativa subsp. japonica GN=Os02g0806900 PE=2 SV=1 605 857 2.0E-40
sp|Q8KZM9|BIOF_BACNA Putative 8-amino-7-oxononanoate synthase OS=Bacillus subtilis subsp. natto GN=bioF PE=3 SV=1 608 848 2.0E-40
sp|B0JQZ0|BIOF_MICAN Putative 8-amino-7-oxononanoate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=bioF PE=3 SV=1 605 848 2.0E-40
sp|Q81I05|PPAT_BACCR Putative pyridoxal phosphate-dependent acyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_0621 PE=3 SV=1 605 1017 4.0E-40
sp|P37419|KBL_SALTY 2-amino-3-ketobutyrate coenzyme A ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kbl PE=3 SV=2 602 1020 4.0E-40
sp|Q7G4P2|LCB1C_ORYSJ Long chain base biosynthesis protein 1c OS=Oryza sativa subsp. japonica GN=Os10g0189600 PE=2 SV=2 598 857 5.0E-40
sp|Q7NNL4|BIOF_GLOVI Putative 8-amino-7-oxononanoate synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=bioF PE=3 SV=1 605 833 7.0E-40
sp|P0AB79|KBL_SHIFL 2-amino-3-ketobutyrate coenzyme A ligase OS=Shigella flexneri GN=kbl PE=3 SV=1 602 1020 8.0E-40
sp|P0AB77|KBL_ECOLI 2-amino-3-ketobutyrate coenzyme A ligase OS=Escherichia coli (strain K12) GN=kbl PE=1 SV=1 602 1020 8.0E-40
sp|P0AB78|KBL_ECO57 2-amino-3-ketobutyrate coenzyme A ligase OS=Escherichia coli O157:H7 GN=kbl PE=3 SV=1 602 1020 8.0E-40
sp|Q6HE48|BIOF_BACHK Putative 8-amino-7-oxononanoate synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=bioF PE=3 SV=1 596 1006 9.0E-40
sp|Q39XE0|BIOF_GEOMG 8-amino-7-oxononanoate synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=bioF PE=3 SV=2 604 847 1.0E-39
sp|Q10P01|LCB1A_ORYSJ Long chain base biosynthesis protein 1a OS=Oryza sativa subsp. japonica GN=Os03g0252800 PE=2 SV=1 605 862 1.0E-39
sp|P41888|TNR3_SCHPO Thiamine pyrophosphokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tnr3 PE=3 SV=1 107 355 2.0E-39
sp|Q31E54|BIOF_THICR 8-amino-7-oxononanoate synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=bioF PE=3 SV=1 600 1018 2.0E-39
sp|Q635G4|BIOF_BACCZ Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain ZK / E33L) GN=bioF PE=3 SV=1 596 1006 3.0E-39
sp|B7JLX2|BIOF_BACC0 Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain AH820) GN=bioF PE=3 SV=1 596 1006 3.0E-39
sp|Q81MB0|BIOF_BACAN Putative 8-amino-7-oxononanoate synthase OS=Bacillus anthracis GN=bioF PE=3 SV=1 596 1006 3.0E-39
sp|A8FDG9|BIOF_BACP2 8-amino-7-oxononanoate synthase OS=Bacillus pumilus (strain SAFR-032) GN=BPUM_1604 PE=3 SV=2 590 849 4.0E-39
sp|P22806|BIOF_LYSSH 8-amino-7-oxononanoate synthase OS=Lysinibacillus sphaericus GN=bioF PE=1 SV=1 600 1017 4.0E-39
sp|Q55FL5|SPTC1_DICDI Serine palmitoyltransferase 1 OS=Dictyostelium discoideum GN=sptA PE=3 SV=1 596 895 4.0E-39
sp|P53556|BIOF2_BACSU 8-amino-7-oxononanoate synthase 2 OS=Bacillus subtilis (strain 168) GN=bioF PE=1 SV=1 608 848 4.0E-39
sp|O66875|BIOF_AQUAE Putative 8-amino-7-oxononanoate synthase OS=Aquifex aeolicus (strain VF5) GN=bioF PE=3 SV=1 606 849 4.0E-39
sp|P9WQ85|BIOF2_MYCTU Putative 8-amino-7-oxononanoate synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bioF2 PE=1 SV=1 607 836 5.0E-39
sp|P9WQ84|BIOF2_MYCTO Putative 8-amino-7-oxononanoate synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bioF2 PE=3 SV=1 607 836 5.0E-39
sp|Q3M9A4|BIOF_ANAVT Putative 8-amino-7-oxononanoate synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=bioF PE=3 SV=1 605 847 7.0E-39
sp|A7Z5B4|BIOF2_BACMF Putative 8-amino-7-oxononanoate synthase 2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=bioF PE=3 SV=1 608 1016 8.0E-39
sp|A9VG56|BIOF_BACWK Putative 8-amino-7-oxononanoate synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=bioF PE=3 SV=1 596 1017 1.0E-38
sp|B7IWN1|BIOF_BACC2 Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain G9842) GN=bioF PE=3 SV=1 596 1015 2.0E-38
sp|Q818X0|BIOF_BACCR Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=bioF PE=3 SV=1 596 1006 2.0E-38
sp|B7HAZ0|BIOF_BACC4 Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain B4264) GN=bioF PE=3 SV=1 596 1006 2.0E-38
sp|P08262|HEM1_BRADU 5-aminolevulinate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hemA PE=3 SV=2 579 857 2.0E-38
sp|A0RIB9|BIOF_BACAH Putative 8-amino-7-oxononanoate synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=bioF PE=3 SV=1 596 1006 2.0E-38
sp|B9IWY0|BIOF_BACCQ Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain Q1) GN=bioF PE=3 SV=1 596 1015 2.0E-38
sp|B7HNN4|BIOF_BACC7 Putative 8-amino-7-oxononanoate synthase OS=Bacillus cereus (strain AH187) GN=bioF PE=3 SV=1 596 1015 2.0E-38
sp|B0C205|BIOF_ACAM1 Putative 8-amino-7-oxononanoate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=bioF PE=3 SV=1 600 847 2.0E-38
sp|Q21FY4|BIOF_SACD2 8-amino-7-oxononanoate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=bioF PE=3 SV=1 599 1016 4.0E-38
sp|B1XL23|BIOF_SYNP2 Putative 8-amino-7-oxononanoate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=bioF PE=3 SV=1 598 847 6.0E-38
sp|B9M8U3|BIOF_GEODF 8-amino-7-oxononanoate synthase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=bioF PE=3 SV=1 605 1017 1.0E-37
sp|A5G6I9|BIOF_GEOUR 8-amino-7-oxononanoate synthase OS=Geobacter uraniireducens (strain Rf4) GN=bioF PE=3 SV=1 605 850 4.0E-37
sp|B5EEV8|BIOF_GEOBB 8-amino-7-oxononanoate synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=bioF PE=3 SV=1 603 857 6.0E-37
sp|Q2W3L2|BIOF_MAGSA Putative 8-amino-7-oxononanoate synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=bioF PE=3 SV=1 605 1012 7.0E-37
sp|A4SPR6|BIOF_AERS4 8-amino-7-oxononanoate synthase OS=Aeromonas salmonicida (strain A449) GN=bioF PE=3 SV=1 605 1012 1.0E-36
sp|Q94IB8|LCB1_ARATH Long chain base biosynthesis protein 1 OS=Arabidopsis thaliana GN=LCB1 PE=1 SV=1 598 860 2.0E-36
sp|B5ELF7|BIOF_ACIF5 8-amino-7-oxononanoate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=bioF PE=3 SV=1 597 833 3.0E-36
sp|B7J3Y7|BIOF_ACIF2 8-amino-7-oxononanoate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=bioF PE=3 SV=1 597 833 3.0E-36
sp|P25045|LCB1_YEAST Serine palmitoyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB1 PE=1 SV=2 602 863 4.0E-36
sp|B8HTV6|BIOF_CYAP4 Putative 8-amino-7-oxononanoate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=bioF PE=3 SV=1 603 847 5.0E-36
sp|B3EAE0|BIOF_GEOLS 8-amino-7-oxononanoate synthase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=bioF PE=3 SV=1 579 1017 7.0E-36
sp|B2J1W1|BIOF_NOSP7 Putative 8-amino-7-oxononanoate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=bioF PE=3 SV=1 571 847 1.0E-35
sp|B7KD70|BIOF_CYAP7 Putative 8-amino-7-oxononanoate synthase OS=Cyanothece sp. (strain PCC 7424) GN=bioF PE=3 SV=1 605 848 2.0E-35
sp|Q7W9I4|BIOF_BORPA Putative 8-amino-7-oxononanoate synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bioF PE=3 SV=1 605 1012 2.0E-35
sp|A0KIC7|BIOF_AERHH 8-amino-7-oxononanoate synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=bioF PE=3 SV=1 594 1012 3.0E-35
sp|Q1I3N7|BIOF_PSEE4 8-amino-7-oxononanoate synthase OS=Pseudomonas entomophila (strain L48) GN=bioF PE=3 SV=1 605 1015 3.0E-35
sp|A6UWX3|BIOF_META3 Putative 8-amino-7-oxononanoate synthase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=bioF PE=3 SV=1 605 860 3.0E-35
sp|Q7VWP1|BIOF_BORPE Putative 8-amino-7-oxononanoate synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bioF PE=3 SV=1 551 1012 4.0E-35
sp|Q3J9D6|BIOF_NITOC 8-amino-7-oxononanoate synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=bioF PE=3 SV=1 603 1016 6.0E-35
sp|B3PI88|BIOF_CELJU 8-amino-7-oxononanoate synthase OS=Cellvibrio japonicus (strain Ueda107) GN=bioF PE=3 SV=2 605 1021 8.0E-35
sp|B5YFU5|BIOF_THEYD Putative 8-amino-7-oxononanoate synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=bioF PE=3 SV=1 593 861 9.0E-35
sp|A9HJ57|BIOF_GLUDA 8-amino-7-oxononanoate synthase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=GDI1920 PE=3 SV=2 605 857 1.0E-34
sp|Q7WH76|BIOF_BORBR Putative 8-amino-7-oxononanoate synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bioF PE=3 SV=1 605 1012 1.0E-34
sp|A6UQL9|BIOF_METVS Putative 8-amino-7-oxononanoate synthase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=bioF PE=3 SV=1 605 857 2.0E-34
sp|Q3A3Z8|BIOF_PELCD Putative 8-amino-7-oxononanoate synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=bioF PE=3 SV=1 605 862 3.0E-34
sp|A1AQT1|BIOF_PELPD 8-amino-7-oxononanoate synthase OS=Pelobacter propionicus (strain DSM 2379) GN=bioF PE=3 SV=1 586 1006 5.0E-34
sp|A4VR87|BIOF_PSEU5 8-amino-7-oxononanoate synthase OS=Pseudomonas stutzeri (strain A1501) GN=bioF PE=3 SV=1 603 857 5.0E-34
sp|P74770|BIOF_SYNY3 Putative 8-amino-7-oxononanoate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=bioF PE=3 SV=2 603 847 6.0E-34
sp|B7K0L9|BIOF_CYAP8 Putative 8-amino-7-oxononanoate synthase OS=Cyanothece sp. (strain PCC 8801) GN=bioF PE=3 SV=1 605 848 9.0E-34
sp|Q8YZT3|BIOF_NOSS1 Putative 8-amino-7-oxononanoate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=bioF PE=3 SV=1 605 847 9.0E-34
sp|Q2SBD5|BIOF_HAHCH 8-amino-7-oxononanoate synthase OS=Hahella chejuensis (strain KCTC 2396) GN=bioF PE=3 SV=1 605 1010 1.0E-33
sp|B8F713|BIOF_HAEPS Putative 8-amino-7-oxononanoate synthase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=bioF PE=3 SV=1 586 833 1.0E-33
sp|Q75DX7|HEM1_ASHGO 5-aminolevulinate synthase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HEM1 PE=3 SV=1 552 1022 2.0E-33
sp|O88986|KBL_MOUSE 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Mus musculus GN=Gcat PE=1 SV=2 605 1019 3.0E-33
sp|B0KJ54|BIOF_PSEPG 8-amino-7-oxononanoate synthase OS=Pseudomonas putida (strain GB-1) GN=bioF PE=3 SV=1 603 857 3.0E-33
sp|P78698|HEM1_KLULA 5-aminolevulinate synthase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HEM1 PE=3 SV=2 609 1022 4.0E-33
sp|A4G5N9|BIOF_HERAR 8-amino-7-oxononanoate synthase OS=Herminiimonas arsenicoxydans GN=bioF PE=3 SV=1 605 862 4.0E-33
sp|Q5DZH9|BIOF_VIBF1 8-amino-7-oxononanoate synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=bioF PE=3 SV=2 605 848 5.0E-33
sp|Q9I617|BIOF_PSEAE 8-amino-7-oxononanoate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bioF PE=3 SV=1 605 857 5.0E-33
sp|A8ZUS7|BIOF_DESOH Putative 8-amino-7-oxononanoate synthase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=bioF PE=3 SV=1 598 1007 5.0E-33
sp|Q48CS2|BIOF_PSE14 8-amino-7-oxononanoate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=bioF PE=3 SV=1 605 857 5.0E-33
sp|Q02TR5|BIOF_PSEAB 8-amino-7-oxononanoate synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=bioF PE=3 SV=1 605 857 6.0E-33
sp|B7V486|BIOF_PSEA8 8-amino-7-oxononanoate synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=bioF PE=3 SV=1 605 857 6.0E-33
sp|Q88QX1|BIOF_PSEPK 8-amino-7-oxononanoate synthase OS=Pseudomonas putida (strain KT2440) GN=bioF PE=3 SV=1 603 857 7.0E-33
sp|Q58694|BIOF_METJA Putative 8-amino-7-oxononanoate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=bioF PE=3 SV=1 604 1016 7.0E-33
sp|A6UYW1|BIOF_PSEA7 8-amino-7-oxononanoate synthase OS=Pseudomonas aeruginosa (strain PA7) GN=bioF PE=3 SV=1 605 857 7.0E-33
sp|Q119K2|BIOF_TRIEI Putative 8-amino-7-oxononanoate synthase OS=Trichodesmium erythraeum (strain IMS101) GN=bioF PE=3 SV=1 603 848 8.0E-33
sp|Q4ZMA9|BIOF_PSEU2 8-amino-7-oxononanoate synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=bioF PE=3 SV=1 605 857 1.0E-32
sp|Q88A97|BIOF_PSESM 8-amino-7-oxononanoate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=bioF PE=3 SV=1 605 857 1.0E-32
sp|A1U4B1|BIOF_MARHV 8-amino-7-oxononanoate synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=bioF PE=3 SV=1 597 860 2.0E-32
sp|B2IH50|BIOF_BEII9 8-amino-7-oxononanoate synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=Bind_0814 PE=3 SV=1 596 842 3.0E-32
sp|A0L3L7|BIOF_MAGMM Putative 8-amino-7-oxononanoate synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=bioF PE=3 SV=1 605 1005 4.0E-32
sp|Q6FXE3|HEM1_CANGA 5-aminolevulinate synthase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HEM1 PE=3 SV=1 609 1022 4.0E-32
sp|Q7VL09|BIOF_HAEDU 8-amino-7-oxononanoate synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=HD_1684 PE=3 SV=1 584 833 4.0E-32
sp|P22557|HEM0_HUMAN 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Homo sapiens GN=ALAS2 PE=1 SV=2 538 862 4.0E-32
sp|Q5R557|HEM0_PONAB 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Pongo abelii GN=ALAS2 PE=2 SV=1 538 862 4.0E-32
sp|B1JE54|BIOF_PSEPW 8-amino-7-oxononanoate synthase OS=Pseudomonas putida (strain W619) GN=bioF PE=3 SV=1 605 857 5.0E-32
sp|Q9CJU0|BIOF_PASMU Putative 8-amino-7-oxononanoate synthase OS=Pasteurella multocida (strain Pm70) GN=bioF PE=3 SV=1 605 833 5.0E-32
sp|Q1RIV2|HEM1_RICBR 5-aminolevulinate synthase OS=Rickettsia bellii (strain RML369-C) GN=hemA PE=3 SV=1 611 1023 5.0E-32
sp|P08680|HEM0_MOUSE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Mus musculus GN=Alas2 PE=1 SV=3 536 862 6.0E-32
sp|B5EUP9|BIOF_VIBFM 8-amino-7-oxononanoate synthase OS=Vibrio fischeri (strain MJ11) GN=bioF PE=3 SV=1 605 848 7.0E-32
sp|A6W0Y0|BIOF_MARMS 8-amino-7-oxononanoate synthase OS=Marinomonas sp. (strain MWYL1) GN=bioF PE=3 SV=1 579 1023 8.0E-32
sp|Q0P5L8|KBL_BOVIN 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Bos taurus GN=GCAT PE=1 SV=1 605 1019 9.0E-32
sp|Q8DJ97|BIOF_THEEB Putative 8-amino-7-oxononanoate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=bioF PE=3 SV=1 605 847 1.0E-31
sp|Q92G23|HEM1_RICCN 5-aminolevulinate synthase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=hemA PE=3 SV=2 611 1023 1.0E-31
sp|P44422|BIOF_HAEIN Putative 8-amino-7-oxononanoate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bioF PE=3 SV=1 586 833 1.0E-31
sp|Q9XT75|HEM0_DELLE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Delphinapterus leucas GN=ALAS2 PE=2 SV=1 538 862 2.0E-31
sp|P26505|HEM1_RHIRD 5-aminolevulinate synthase OS=Rhizobium radiobacter GN=hemA PE=3 SV=1 552 1016 2.0E-31
sp|A2SD53|BIOF_METPP 8-amino-7-oxononanoate synthase OS=Methylibium petroleiphilum (strain PM1) GN=bioF PE=3 SV=1 605 1007 2.0E-31
sp|Q63147|HEM0_RAT 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Rattus norvegicus GN=Alas2 PE=1 SV=1 579 862 3.0E-31
sp|Q4UJV4|HEM1_RICFE 5-aminolevulinate synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hemA PE=3 SV=1 611 1023 3.0E-31
sp|B3QLR6|BIOF_CHLP8 8-amino-7-oxononanoate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=Cpar_2015 PE=3 SV=2 596 877 3.0E-31
sp|Q3K5P2|BIOF_PSEPF 8-amino-7-oxononanoate synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=bioF PE=3 SV=1 605 857 4.0E-31
sp|Q4K4T3|BIOF_PSEF5 8-amino-7-oxononanoate synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=bioF PE=3 SV=1 605 857 4.0E-31
sp|A5UCE4|BIOF_HAEIE Putative 8-amino-7-oxononanoate synthase OS=Haemophilus influenzae (strain PittEE) GN=bioF PE=3 SV=1 586 833 5.0E-31
sp|B8J3V0|BIOF_DESDA Putative 8-amino-7-oxononanoate synthase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=bioF PE=3 SV=1 603 833 5.0E-31
sp|Q9KSZ3|BIOF_VIBCH 8-amino-7-oxononanoate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=bioF PE=3 SV=1 558 848 5.0E-31
sp|B8GTH6|BIOF_THISH 8-amino-7-oxononanoate synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=bioF PE=3 SV=1 559 1014 5.0E-31
sp|Q3ZC31|HEM0_BOVIN 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Bos taurus GN=ALAS2 PE=2 SV=1 538 862 6.0E-31
sp|Q0VMD1|BIOF_ALCBS 8-amino-7-oxononanoate synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=bioF PE=3 SV=1 605 1012 6.0E-31
sp|Q7NPW2|BIOF_CHRVO 8-amino-7-oxononanoate synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=bioF PE=3 SV=1 605 860 7.0E-31
sp|Q609V1|BIOF_METCA 8-amino-7-oxononanoate synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=bioF PE=3 SV=1 605 1012 7.0E-31
sp|B7VH15|BIOF_VIBTL 8-amino-7-oxononanoate synthase OS=Vibrio tasmaniensis (strain LGP32) GN=bioF PE=3 SV=2 597 848 1.0E-30
sp|Q1DCV8|BIOF_MYXXD 8-amino-7-oxononanoate synthase OS=Myxococcus xanthus (strain DK 1622) GN=bioF PE=3 SV=1 605 830 1.0E-30
sp|A4XZR8|BIOF_PSEMY 8-amino-7-oxononanoate synthase OS=Pseudomonas mendocina (strain ymp) GN=bioF PE=3 SV=1 605 857 1.0E-30
sp|Q7RVY5|HEM1_NEUCR 5-aminolevulinate synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alv-1 PE=3 SV=2 552 1035 1.0E-30
sp|A1KVF6|BIOF_NEIMF Putative 8-amino-7-oxononanoate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=bioF PE=3 SV=1 586 833 1.0E-30
sp|P18079|HEM1_RHOCB 5-aminolevulinate synthase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=hemA PE=1 SV=2 579 1014 2.0E-30
sp|Q2Y9Y8|BIOF_NITMU 8-amino-7-oxononanoate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=bioF PE=3 SV=1 605 1016 2.0E-30
sp|A5UJ44|BIOF_HAEIG Putative 8-amino-7-oxononanoate synthase OS=Haemophilus influenzae (strain PittGG) GN=bioF PE=3 SV=1 586 833 2.0E-30
sp|Q4QKR3|BIOF_HAEI8 Putative 8-amino-7-oxononanoate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=bioF PE=3 SV=1 586 833 2.0E-30
sp|A1ITK1|BIOF_NEIMA Putative 8-amino-7-oxononanoate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=bioF PE=3 SV=1 586 833 2.0E-30
sp|A9M251|BIOF_NEIM0 Putative 8-amino-7-oxononanoate synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=bioF PE=3 SV=2 586 833 2.0E-30
sp|B4RP93|BIOF_NEIG2 Putative 8-amino-7-oxononanoate synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=bioF PE=3 SV=1 586 833 3.0E-30
sp|P38092|HEM1_EMENI 5-aminolevulinate synthase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hemA PE=3 SV=2 552 1032 3.0E-30
sp|Q9K0U0|BIOF_NEIMB Putative 8-amino-7-oxononanoate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=bioF PE=3 SV=1 586 833 3.0E-30
sp|Q5F6R6|BIOF_NEIG1 Putative 8-amino-7-oxononanoate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=bioF PE=3 SV=1 586 833 3.0E-30
sp|Q6BX71|HEM1_DEBHA 5-aminolevulinate synthase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HEM1 PE=3 SV=1 609 1022 3.0E-30
sp|O75600|KBL_HUMAN 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial OS=Homo sapiens GN=GCAT PE=1 SV=1 605 1019 4.0E-30
sp|B6ESC6|BIOF_ALISL 8-amino-7-oxononanoate synthase OS=Aliivibrio salmonicida (strain LFI1238) GN=bioF PE=3 SV=1 599 848 4.0E-30
sp|A7HP29|BIOF_PARL1 Putative 8-amino-7-oxononanoate synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=bioF PE=3 SV=2 603 847 4.0E-30
sp|Q5SHZ8|BIKB_THET8 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA1582 PE=1 SV=1 605 860 4.0E-30
sp|A6QLI6|HEM1_BOVIN 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Bos taurus GN=ALAS1 PE=2 SV=1 609 919 4.0E-30
sp|Q47C04|BIOF_DECAR 8-amino-7-oxononanoate synthase OS=Dechloromonas aromatica (strain RCB) GN=bioF PE=3 SV=1 598 860 5.0E-30
sp|Q0A5W2|BIOF_ALKEH 8-amino-7-oxononanoate synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=bioF PE=3 SV=1 634 1016 7.0E-30
sp|P43090|HEM0_OPSTA 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Opsanus tau GN=alas2 PE=2 SV=1 543 857 8.0E-30
sp|P13195|HEM1_RAT 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Rattus norvegicus GN=Alas1 PE=2 SV=2 609 919 8.0E-30
sp|Q8VXZ0|NUD20_ARATH Nudix hydrolase 20, chloroplastic OS=Arabidopsis thaliana GN=NUDT20 PE=2 SV=1 91 357 8.0E-30
sp|B1I4F9|BIOF_DESAP Putative 8-amino-7-oxononanoate synthase OS=Desulforudis audaxviator (strain MP104C) GN=bioF PE=3 SV=1 609 1012 9.0E-30
sp|B4UCB1|BIOF_ANASK 8-amino-7-oxononanoate synthase OS=Anaeromyxobacter sp. (strain K) GN=bioF PE=3 SV=1 605 830 1.0E-29
sp|Q87QN5|BIOF_VIBPA 8-amino-7-oxononanoate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=bioF PE=3 SV=2 597 1009 1.0E-29
sp|A1K6Q1|BIOF_AZOSB 8-amino-7-oxononanoate synthase OS=Azoarcus sp. (strain BH72) GN=bioF PE=3 SV=1 605 830 1.0E-29
sp|B8J637|BIOF_ANAD2 8-amino-7-oxononanoate synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=bioF PE=3 SV=1 603 830 2.0E-29
sp|Q0BUV6|BIOF_GRABC 8-amino-7-oxononanoate synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=GbCGDNIH1_0498 PE=3 SV=2 603 857 2.0E-29
sp|A7HG96|BIOF_ANADF 8-amino-7-oxononanoate synthase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=bioF PE=3 SV=1 603 830 2.0E-29
sp|P09950|HEM1_YEAST 5-aminolevulinate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM1 PE=1 SV=1 624 1022 3.0E-29
sp|P43089|HEM1_PARDP 5-aminolevulinate synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=hemA PE=3 SV=2 579 847 3.0E-29
sp|Q7MLU9|BIOF_VIBVY 8-amino-7-oxononanoate synthase OS=Vibrio vulnificus (strain YJ016) GN=bioF PE=3 SV=1 597 848 4.0E-29
sp|Q9YHT4|HEM0_DANRE 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Danio rerio GN=alas2 PE=2 SV=1 609 857 6.0E-29
sp|Q5NZF5|BIOF_AROAE 8-amino-7-oxononanoate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=bioF PE=3 SV=1 605 860 9.0E-29
sp|Q04512|HEM1_RHOS4 5-aminolevulinate synthase 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hemA PE=3 SV=1 611 847 9.0E-29
sp|Q8D8N0|BIOF_VIBVU 8-amino-7-oxononanoate synthase OS=Vibrio vulnificus (strain CMCP6) GN=bioF PE=3 SV=1 597 848 9.0E-29
sp|Q9ZCB8|HEM1_RICPR 5-aminolevulinate synthase OS=Rickettsia prowazekii (strain Madrid E) GN=hemA PE=3 SV=1 611 857 1.0E-28
sp|Q47829|BIOF_ESCVU 8-amino-7-oxononanoate synthase OS=Escherichia vulneris GN=bioF PE=3 SV=1 562 1018 1.0E-28
sp|Q6LPR3|BIOF_PHOPR 8-amino-7-oxononanoate synthase OS=Photobacterium profundum GN=bioF PE=3 SV=2 558 848 2.0E-28
sp|A5VXF2|BIOF_PSEP1 8-amino-7-oxononanoate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=bioF PE=3 SV=1 603 857 2.0E-28
sp|Q06965|HEM0_RHOS4 5-aminolevulinate synthase 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hemT PE=3 SV=1 579 860 2.0E-28
sp|Q9XS79|HEM1_DELLE 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Delphinapterus leucas GN=ALAS1 PE=2 SV=1 609 925 4.0E-28
sp|Q0APZ9|BIOF_MARMM 8-amino-7-oxononanoate synthase OS=Maricaulis maris (strain MCS10) GN=bioF PE=3 SV=1 605 857 4.0E-28
sp|A7MX30|BIOF_VIBCB 8-amino-7-oxononanoate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=bioF PE=3 SV=1 583 1015 5.0E-28
sp|Q68VS3|HEM1_RICTY 5-aminolevulinate synthase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=hemA PE=3 SV=1 611 857 6.0E-28
sp|Q2IF62|BIOF_ANADE 8-amino-7-oxononanoate synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=bioF PE=3 SV=1 603 830 7.0E-28
sp|A9MTI7|BIOF_SALPB 8-amino-7-oxononanoate synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=bioF PE=3 SV=1 595 860 1.0E-27
sp|A6T6L6|BIOF_KLEP7 8-amino-7-oxononanoate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=bioF PE=3 SV=1 603 1010 1.0E-27
sp|B7LJY7|BIOF_ESCF3 8-amino-7-oxononanoate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=bioF PE=3 SV=1 595 1010 1.0E-27
sp|Q8Z892|BIOF_SALTI 8-amino-7-oxononanoate synthase OS=Salmonella typhi GN=bioF PE=3 SV=1 595 860 1.0E-27
sp|B5R762|BIOF_SALG2 8-amino-7-oxononanoate synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=bioF PE=3 SV=1 595 860 1.0E-27
sp|B5QX66|BIOF_SALEP 8-amino-7-oxononanoate synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=bioF PE=3 SV=1 595 860 1.0E-27
sp|B4TC49|BIOF_SALHS 8-amino-7-oxononanoate synthase OS=Salmonella heidelberg (strain SL476) GN=bioF PE=3 SV=1 595 860 2.0E-27
sp|Q8ZQQ7|BIOF_SALTY 8-amino-7-oxononanoate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bioF PE=3 SV=1 595 860 2.0E-27
sp|C4LK80|BIOWF_CORK4 Biotin biosynthesis bifunctional protein BioWF OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=bioWF PE=3 SV=1 605 861 2.0E-27
sp|Q57RG2|BIOF_SALCH 8-amino-7-oxononanoate synthase OS=Salmonella choleraesuis (strain SC-B67) GN=bioF PE=3 SV=1 595 860 2.0E-27
sp|C0PWY3|BIOF_SALPC 8-amino-7-oxononanoate synthase OS=Salmonella paratyphi C (strain RKS4594) GN=bioF PE=3 SV=1 595 860 2.0E-27
sp|A1T8U6|BIOF_MYCVP 8-amino-7-oxononanoate synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_2789 PE=3 SV=1 605 833 2.0E-27
sp|B4TQU0|BIOF_SALSV 8-amino-7-oxononanoate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=bioF PE=3 SV=1 595 860 2.0E-27
sp|Q12F38|BIOF1_POLSJ 8-amino-7-oxononanoate synthase 1 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=bioF1 PE=3 SV=1 603 800 2.0E-27
sp|Q6CCW0|HEM1_YARLI 5-aminolevulinate synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HEM1 PE=3 SV=1 543 1032 2.0E-27
sp|B5BC30|BIOF_SALPK 8-amino-7-oxononanoate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=bioF PE=3 SV=1 595 860 3.0E-27
sp|Q5PG49|BIOF_SALPA 8-amino-7-oxononanoate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=bioF PE=3 SV=1 595 860 3.0E-27
sp|B5F073|BIOF_SALA4 8-amino-7-oxononanoate synthase OS=Salmonella agona (strain SL483) GN=bioF PE=3 SV=1 595 860 3.0E-27
sp|B4ESU4|BIOF_PROMH 8-amino-7-oxononanoate synthase OS=Proteus mirabilis (strain HI4320) GN=bioF PE=3 SV=1 603 860 3.0E-27
sp|A9MJE5|BIOF_SALAR 8-amino-7-oxononanoate synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=bioF PE=3 SV=1 595 860 4.0E-27
sp|P43091|HEM1_OPSTA 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Opsanus tau GN=alas1 PE=2 SV=1 553 922 5.0E-27
sp|O94069|HEM1_CANAL 5-aminolevulinate synthase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HEM1 PE=3 SV=1 609 857 5.0E-27
sp|P18080|HEM0_CHICK 5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Gallus gallus GN=ALAS2 PE=2 SV=2 633 860 7.0E-27
sp|A1WVM6|BIOF_HALHL 8-amino-7-oxononanoate synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=bioF PE=3 SV=1 590 833 9.0E-27
sp|B4SZJ8|BIOF_SALNS 8-amino-7-oxononanoate synthase OS=Salmonella newport (strain SL254) GN=bioF PE=3 SV=1 595 860 1.0E-26
sp|B5FP62|BIOF_SALDC 8-amino-7-oxononanoate synthase OS=Salmonella dublin (strain CT_02021853) GN=bioF PE=3 SV=1 595 860 1.0E-26
sp|A3Q146|BIOF_MYCSJ 8-amino-7-oxononanoate synthase OS=Mycobacterium sp. (strain JLS) GN=Mjls_3094 PE=3 SV=1 604 833 1.0E-26
sp|Q8VC19|HEM1_MOUSE 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Mus musculus GN=Alas1 PE=1 SV=2 609 919 1.0E-26
sp|P08080|HEM1_RHIME 5-aminolevulinate synthase OS=Rhizobium meliloti (strain 1021) GN=hemA PE=3 SV=2 552 833 2.0E-26
sp|Q6A6M4|BIOWF_PROAC Biotin biosynthesis bifunctional protein BioWF OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=PPA1866 PE=3 SV=1 604 833 2.0E-26
sp|Q92403|HEM1_AGABI 5-aminolevulinate synthase, mitochondrial OS=Agaricus bisporus GN=hem1 PE=2 SV=1 609 857 2.0E-26
sp|O14092|HEM1_SCHPO 5-aminolevulinate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem1 PE=3 SV=1 539 857 3.0E-26
sp|Q5R9R9|HEM1_PONAB 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Pongo abelii GN=ALAS1 PE=2 SV=1 521 919 3.0E-26
sp|Q1B7F0|BIOF_MYCSS 8-amino-7-oxononanoate synthase OS=Mycobacterium sp. (strain MCS) GN=Mmcs_3077 PE=3 SV=1 604 833 4.0E-26
sp|A1UHM3|BIOF_MYCSK 8-amino-7-oxononanoate synthase OS=Mycobacterium sp. (strain KMS) GN=Mkms_3137 PE=3 SV=1 604 833 4.0E-26
sp|P13196|HEM1_HUMAN 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Homo sapiens GN=ALAS1 PE=1 SV=2 609 919 5.0E-26
sp|B8IBW2|BIOF_METNO 8-amino-7-oxononanoate synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=Mnod_6357 PE=3 SV=1 605 830 7.0E-26
sp|D4H9Y2|BIOWF_PROAS Biotin biosynthesis bifunctional protein BioWF OS=Propionibacterium acnes (strain SK137) GN=HMPREF0675_4919 PE=3 SV=1 604 833 7.0E-26
sp|P0C026|NUD24_ARATH Nudix hydrolase 24, chloroplastic OS=Arabidopsis thaliana GN=NUDT24 PE=2 SV=1 103 354 7.0E-26
sp|B0SZS9|BIOF_CAUSK Putative 8-amino-7-oxononanoate synthase OS=Caulobacter sp. (strain K31) GN=bioF PE=3 SV=1 603 833 9.0E-26
sp|A5FZN8|BIOF_ACICJ Putative 8-amino-7-oxononanoate synthase OS=Acidiphilium cryptum (strain JF-5) GN=bioF PE=3 SV=1 631 1007 1.0E-25
sp|B5XZ74|BIOF_KLEP3 8-amino-7-oxononanoate synthase OS=Klebsiella pneumoniae (strain 342) GN=bioF PE=3 SV=1 603 1012 1.0E-25
sp|Q9A7Z1|BIOF_CAUCR Putative 8-amino-7-oxononanoate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=bioF PE=3 SV=2 577 842 2.0E-25
sp|B8GVE2|BIOF_CAUCN Putative 8-amino-7-oxononanoate synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=bioF PE=3 SV=1 577 842 2.0E-25
sp|B1Z7Y8|BIOF_METPB 8-amino-7-oxononanoate synthase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=Mpop_0781 PE=3 SV=1 603 830 2.0E-25
sp|Q1GZA7|BIOF_METFK 8-amino-7-oxononanoate synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=bioF PE=3 SV=2 603 804 3.0E-25
sp|B2VBT8|BIOF_ERWT9 8-amino-7-oxononanoate synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=bioF PE=3 SV=1 561 861 3.0E-25
sp|A9W106|BIOF_METEP 8-amino-7-oxononanoate synthase OS=Methylobacterium extorquens (strain PA1) GN=Mext_0857 PE=3 SV=1 605 830 5.0E-25
sp|A4T9L3|BIOF_MYCGI 8-amino-7-oxononanoate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_3628 PE=3 SV=1 605 833 6.0E-25
sp|B7L0L2|BIOF_METC4 8-amino-7-oxononanoate synthase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=Mchl_0816 PE=3 SV=1 605 830 6.0E-25
sp|A4W8B8|BIOF_ENT38 8-amino-7-oxononanoate synthase OS=Enterobacter sp. (strain 638) GN=bioF PE=3 SV=1 595 847 7.0E-25
sp|B2UBJ3|BIOF_RALPJ 8-amino-7-oxononanoate synthase OS=Ralstonia pickettii (strain 12J) GN=bioF PE=3 SV=1 605 857 7.0E-25
sp|Q8GW43|BIOF_ARATH 8-amino-7-oxononanoate synthase OS=Arabidopsis thaliana GN=BIOF PE=1 SV=2 599 845 8.0E-25
sp|Q146K3|BIOF_BURXL 8-amino-7-oxononanoate synthase OS=Burkholderia xenovorans (strain LB400) GN=bioF PE=3 SV=1 605 862 8.0E-25
sp|Q81ZZ4|BIOF_NITEU 8-amino-7-oxononanoate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=bioF PE=3 SV=1 605 1009 9.0E-25
sp|A1VUJ6|BIOF_POLNA 8-amino-7-oxononanoate synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=bioF PE=3 SV=2 605 862 1.0E-24
sp|P07997|HEM1_CHICK 5-aminolevulinate synthase, nonspecific, mitochondrial OS=Gallus gallus GN=ALAS1 PE=2 SV=2 609 925 3.0E-24
sp|Q1QYD6|BIOF_CHRSD 8-amino-7-oxononanoate synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=bioF PE=3 SV=1 634 857 3.0E-24
sp|A7MJ02|BIOF_CROS8 8-amino-7-oxononanoate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=bioF PE=3 SV=1 606 830 6.0E-24
sp|B2SWS7|BIOF_BURPP 8-amino-7-oxononanoate synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=bioF PE=3 SV=1 605 862 8.0E-24
sp|Q7N6Q6|BIOF_PHOLL 8-amino-7-oxononanoate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=bioF PE=3 SV=1 605 848 1.0E-23
sp|Q6D3C0|BIOF_PECAS 8-amino-7-oxononanoate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=bioF PE=3 SV=1 605 822 1.0E-23
sp|Q8XZC3|BIOF_RALSO 8-amino-7-oxononanoate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=bioF PE=3 SV=1 605 862 2.0E-23
sp|A1JS67|BIOF_YERE8 8-amino-7-oxononanoate synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=bioF PE=3 SV=1 586 847 2.0E-23
sp|A9BV10|BIOF_DELAS 8-amino-7-oxononanoate synthase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=bioF PE=3 SV=1 605 860 2.0E-23
sp|Q3Z408|BIOF_SHISS 8-amino-7-oxononanoate synthase OS=Shigella sonnei (strain Ss046) GN=bioF PE=3 SV=1 572 860 2.0E-23
sp|B1Y500|BIOF_LEPCP 8-amino-7-oxononanoate synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=bioF PE=3 SV=1 605 862 3.0E-23
sp|Q0TJS2|BIOF_ECOL5 8-amino-7-oxononanoate synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=bioF PE=3 SV=1 595 860 3.0E-23
sp|B7MQM9|BIOF_ECO81 8-amino-7-oxononanoate synthase OS=Escherichia coli O81 (strain ED1a) GN=bioF PE=3 SV=1 595 860 3.0E-23
sp|B7NA75|BIOF_ECOLU 8-amino-7-oxononanoate synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=bioF PE=3 SV=1 572 860 4.0E-23
sp|Q0AE73|BIOF_NITEC 8-amino-7-oxononanoate synthase OS=Nitrosomonas eutropha (strain C91) GN=bioF PE=3 SV=1 605 841 4.0E-23
sp|Q8FJQ2|BIOF_ECOL6 8-amino-7-oxononanoate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=bioF PE=3 SV=1 595 860 4.0E-23
sp|B2JKH6|BIOF_BURP8 8-amino-7-oxononanoate synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=bioF PE=3 SV=1 594 939 5.0E-23
sp|B7LC58|BIOF_ECO55 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain 55989 / EAEC) GN=bioF PE=3 SV=1 572 860 5.0E-23
sp|Q83S45|BIOF_SHIFL 8-amino-7-oxononanoate synthase OS=Shigella flexneri GN=bioF PE=3 SV=1 572 860 6.0E-23
sp|Q0T6I4|BIOF_SHIF8 8-amino-7-oxononanoate synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=bioF PE=3 SV=1 572 860 6.0E-23
sp|B6I7T0|BIOF_ECOSE 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain SE11) GN=bioF PE=3 SV=1 572 860 7.0E-23
sp|A7ZJI5|BIOF_ECO24 8-amino-7-oxononanoate synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=bioF PE=3 SV=1 572 860 7.0E-23
sp|Q1REF4|BIOF_ECOUT 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=bioF PE=3 SV=1 595 860 8.0E-23
sp|A1A918|BIOF_ECOK1 8-amino-7-oxononanoate synthase OS=Escherichia coli O1:K1 / APEC GN=bioF PE=3 SV=1 595 860 8.0E-23
sp|B7MGN4|BIOF_ECO45 8-amino-7-oxononanoate synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=bioF PE=3 SV=1 595 860 8.0E-23
sp|B1IXJ2|BIOF_ECOLC 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=bioF PE=3 SV=1 572 860 8.0E-23
sp|A7ZY32|BIOF_ECOHS 8-amino-7-oxononanoate synthase OS=Escherichia coli O9:H4 (strain HS) GN=bioF PE=3 SV=1 572 860 8.0E-23
sp|B5YRL5|BIOF_ECO5E 8-amino-7-oxononanoate synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=bioF PE=3 SV=1 572 860 1.0E-22
sp|Q8X823|BIOF_ECO57 8-amino-7-oxononanoate synthase OS=Escherichia coli O157:H7 GN=bioF PE=3 SV=3 572 860 1.0E-22
sp|Q66D66|BIOF_YERPS 8-amino-7-oxononanoate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=bioF PE=3 SV=1 596 847 1.0E-22
sp|B2K8T1|BIOF_YERPB 8-amino-7-oxononanoate synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=bioF PE=3 SV=1 596 847 1.0E-22
sp|B1JSS3|BIOF_YERPY 8-amino-7-oxononanoate synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=bioF PE=3 SV=1 595 847 1.0E-22
sp|A7FKM8|BIOF_YERP3 8-amino-7-oxononanoate synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=bioF PE=3 SV=1 595 847 1.0E-22
sp|A0QX65|BIOF_MYCS2 8-amino-7-oxononanoate synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=bioF PE=1 SV=1 605 833 1.0E-22
sp|A8AJ11|BIOF_CITK8 8-amino-7-oxononanoate synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=bioF PE=3 SV=1 595 847 2.0E-22
sp|A4TNQ5|BIOF_YERPP 8-amino-7-oxononanoate synthase OS=Yersinia pestis (strain Pestoides F) GN=bioF PE=3 SV=1 596 847 2.0E-22
sp|Q1CFQ4|BIOF_YERPN 8-amino-7-oxononanoate synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=bioF PE=3 SV=1 596 847 2.0E-22
sp|A9R3C9|BIOF_YERPG 8-amino-7-oxononanoate synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=bioF PE=3 SV=1 596 847 2.0E-22
sp|Q7CH66|BIOF_YERPE 8-amino-7-oxononanoate synthase OS=Yersinia pestis GN=bioF PE=3 SV=1 596 847 2.0E-22
sp|Q1C946|BIOF_YERPA 8-amino-7-oxononanoate synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=bioF PE=3 SV=1 596 847 2.0E-22
sp|P12998|BIOF_ECOLI 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain K12) GN=bioF PE=1 SV=1 572 860 2.0E-22
sp|B1X7A6|BIOF_ECODH 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain K12 / DH10B) GN=bioF PE=3 SV=1 572 860 2.0E-22
sp|Q324B6|BIOF_SHIBS 8-amino-7-oxononanoate synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=bioF PE=3 SV=1 572 860 3.0E-22
sp|B2TVF4|BIOF_SHIB3 8-amino-7-oxononanoate synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=bioF PE=3 SV=1 572 860 3.0E-22
sp|B7NNK6|BIOF_ECO7I 8-amino-7-oxononanoate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=bioF PE=3 SV=1 572 860 3.0E-22
sp|Q3JWR6|BIOF_BURP1 8-amino-7-oxononanoate synthase OS=Burkholderia pseudomallei (strain 1710b) GN=bioF PE=3 SV=2 605 860 3.0E-22
sp|B1LM67|BIOF_ECOSM 8-amino-7-oxononanoate synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=bioF PE=3 SV=1 595 860 3.0E-22
sp|Q32I45|BIOF_SHIDS 8-amino-7-oxononanoate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=bioF PE=3 SV=1 572 860 3.0E-22
sp|Q63Y23|BIOF_BURPS 8-amino-7-oxononanoate synthase OS=Burkholderia pseudomallei (strain K96243) GN=bioF PE=3 SV=1 605 860 4.0E-22
sp|A3N522|BIOF_BURP6 8-amino-7-oxononanoate synthase OS=Burkholderia pseudomallei (strain 668) GN=bioF PE=3 SV=1 605 860 4.0E-22
sp|A3NQS3|BIOF_BURP0 8-amino-7-oxononanoate synthase OS=Burkholderia pseudomallei (strain 1106a) GN=bioF PE=3 SV=1 605 860 4.0E-22
sp|A1V819|BIOF_BURMS 8-amino-7-oxononanoate synthase OS=Burkholderia mallei (strain SAVP1) GN=bioF PE=3 SV=1 605 860 4.0E-22
sp|Q62MX1|BIOF_BURMA 8-amino-7-oxononanoate synthase OS=Burkholderia mallei (strain ATCC 23344) GN=bioF PE=3 SV=1 605 860 4.0E-22
sp|A2S7R1|BIOF_BURM9 8-amino-7-oxononanoate synthase OS=Burkholderia mallei (strain NCTC 10229) GN=bioF PE=3 SV=1 605 860 4.0E-22
sp|A3MNG3|BIOF_BURM7 8-amino-7-oxononanoate synthase OS=Burkholderia mallei (strain NCTC 10247) GN=bioF PE=3 SV=1 605 860 4.0E-22
sp|B7ULX3|BIOF_ECO27 8-amino-7-oxononanoate synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=bioF PE=3 SV=1 595 860 5.0E-22
sp|B7M748|BIOF_ECO8A 8-amino-7-oxononanoate synthase OS=Escherichia coli O8 (strain IAI1) GN=bioF PE=3 SV=1 572 860 6.0E-22
sp|B1LYP9|BIOF_METRJ 8-amino-7-oxononanoate synthase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=Mrad2831_0866 PE=3 SV=1 657 847 7.0E-22
sp|Q2NUJ6|BIOF_SODGM 8-amino-7-oxononanoate synthase OS=Sodalis glossinidius (strain morsitans) GN=bioF PE=3 SV=1 650 822 1.0E-21
sp|Q89AK6|BIOF_BUCBP 8-amino-7-oxononanoate synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bioF PE=3 SV=1 592 822 1.0E-21
sp|A6SU64|BIOF_JANMA 8-amino-7-oxononanoate synthase OS=Janthinobacterium sp. (strain Marseille) GN=bioF PE=3 SV=1 605 862 2.0E-21
sp|Q2T1Q2|BIOF_BURTA 8-amino-7-oxononanoate synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=bioF PE=3 SV=1 605 860 4.0E-21
sp|A9HVE9|BIOF_BORPD 8-amino-7-oxononanoate synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=bioF PE=3 SV=1 605 813 4.0E-21
sp|B2AG98|BIOF_CUPTR 8-amino-7-oxononanoate synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=bioF PE=3 SV=1 605 862 9.0E-21
sp|B0UKC8|BIOF_METS4 8-amino-7-oxononanoate synthase OS=Methylobacterium sp. (strain 4-46) GN=M446_5168 PE=3 SV=1 605 832 1.0E-20
sp|B4RFX5|BIOF_PHEZH Putative 8-amino-7-oxononanoate synthase OS=Phenylobacterium zucineum (strain HLK1) GN=bioF PE=3 SV=1 603 847 1.0E-20
sp|Q0KF88|BIOF_CUPNH 8-amino-7-oxononanoate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=bioF PE=3 SV=1 605 1012 2.0E-20
sp|B0U6J0|BIOF_XYLFM 8-amino-7-oxononanoate synthase OS=Xylella fastidiosa (strain M12) GN=bioF PE=3 SV=1 605 832 4.0E-20
sp|A1TTV0|BIOF_ACIAC 8-amino-7-oxononanoate synthase OS=Acidovorax citrulli (strain AAC00-1) GN=bioF PE=3 SV=1 605 800 4.0E-20
sp|Q87DT2|BIOF_XYLFT 8-amino-7-oxononanoate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=bioF PE=3 SV=1 605 832 5.0E-20
sp|B2I9H7|BIOF_XYLF2 8-amino-7-oxononanoate synthase OS=Xylella fastidiosa (strain M23) GN=bioF PE=3 SV=1 605 832 5.0E-20
sp|B8ERL9|BIOF_METSB 8-amino-7-oxononanoate synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=Msil_2132 PE=3 SV=1 603 847 6.0E-20
sp|Q740R7|BIOF_MYCPA 8-amino-7-oxononanoate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_1275 PE=3 SV=1 605 833 1.0E-19
sp|A4JIB5|BIOF_BURVG 8-amino-7-oxononanoate synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=bioF PE=3 SV=1 605 832 3.0E-19
sp|Q9PDM2|BIOF_XYLFA 8-amino-7-oxononanoate synthase OS=Xylella fastidiosa (strain 9a5c) GN=bioF PE=3 SV=1 605 832 6.0E-19
sp|A0QHJ9|BIOF_MYCA1 8-amino-7-oxononanoate synthase OS=Mycobacterium avium (strain 104) GN=MAV_3205 PE=3 SV=1 605 833 6.0E-19
sp|B0RMR1|BIOF_XANCB 8-amino-7-oxononanoate synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=bioF PE=3 SV=1 609 1020 1.0E-18
sp|Q8PDF1|BIOF_XANCP 8-amino-7-oxononanoate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=bioF PE=3 SV=1 609 1020 1.0E-18
sp|Q4UZN9|BIOF_XANC8 8-amino-7-oxononanoate synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=bioF PE=3 SV=1 609 1020 1.0E-18
sp|A5WMQ5|BIOF_MYCTF 8-amino-7-oxononanoate synthase OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11601 PE=3 SV=1 605 833 1.0E-18
sp|A5U2S6|BIOF_MYCTA 8-amino-7-oxononanoate synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1581 PE=3 SV=1 605 833 1.0E-18
sp|A1KJ00|BIOF_MYCBP 8-amino-7-oxononanoate synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1622 PE=3 SV=1 605 833 1.0E-18
sp|P0A4X5|BIOF_MYCBO 8-amino-7-oxononanoate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1596 PE=3 SV=1 605 833 1.0E-18
sp|P9WQ87|BIOF1_MYCTU 8-amino-7-oxononanoate synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bioF1 PE=1 SV=1 605 833 1.0E-18
sp|P9WQ86|BIOF1_MYCTO 8-amino-7-oxononanoate synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bioF1 PE=3 SV=1 605 833 1.0E-18
sp|Q1LS75|BIOF_CUPMC 8-amino-7-oxononanoate synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=bioF PE=3 SV=1 605 862 4.0E-18
sp|O25320|BIOF_HELPY 8-amino-7-oxononanoate synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0598 PE=3 SV=1 608 846 4.0E-18
sp|Q3BYN0|BIOF_XANC5 8-amino-7-oxononanoate synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=bioF PE=3 SV=2 609 1020 4.0E-18
sp|Q8PQD8|BIOF_XANAC 8-amino-7-oxononanoate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=bioF PE=3 SV=1 609 860 7.0E-18
sp|A8GBC6|BIOF_SERP5 8-amino-7-oxononanoate synthase OS=Serratia proteamaculans (strain 568) GN=bioF PE=3 SV=1 596 822 8.0E-18
sp|A9AE46|BIOF_BURM1 8-amino-7-oxononanoate synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=bioF PE=3 SV=1 586 830 4.0E-17
sp|A0KB03|BIOF_BURCH 8-amino-7-oxononanoate synthase OS=Burkholderia cenocepacia (strain HI2424) GN=bioF PE=3 SV=1 600 830 4.0E-17
sp|Q1BT36|BIOF_BURCA 8-amino-7-oxononanoate synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=bioF PE=3 SV=1 600 830 4.0E-17
sp|Q12D74|BIOF2_POLSJ 8-amino-7-oxononanoate synthase 2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=bioF2 PE=3 SV=1 605 849 4.0E-17
sp|Q5H5R0|BIOF_XANOR 8-amino-7-oxononanoate synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=bioF PE=3 SV=2 609 860 1.0E-16
sp|B2SS66|BIOF_XANOP 8-amino-7-oxononanoate synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=bioF PE=3 SV=2 609 860 1.0E-16
sp|Q2P8F2|BIOF_XANOM 8-amino-7-oxononanoate synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=bioF PE=3 SV=1 609 860 1.0E-16
sp|B2HQ90|BIOF_MYCMM 8-amino-7-oxononanoate synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=MMAR_2384 PE=3 SV=1 605 833 1.0E-16
sp|Q9ZLN3|BIOF_HELPJ 8-amino-7-oxononanoate synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_0545 PE=3 SV=1 608 846 2.0E-16
sp|A0PP02|BIOF_MYCUA 8-amino-7-oxononanoate synthase OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_1560 PE=3 SV=1 605 833 2.0E-16
sp|P45487|BIOF_MYCLE 8-amino-7-oxononanoate synthase OS=Mycobacterium leprae (strain TN) GN=ML1217 PE=3 SV=1 605 828 5.0E-16
sp|B8ZR84|BIOF_MYCLB 8-amino-7-oxononanoate synthase OS=Mycobacterium leprae (strain Br4923) GN=MLBr01217 PE=3 SV=1 605 828 5.0E-16
sp|B1YNS0|BIOF_BURA4 8-amino-7-oxononanoate synthase OS=Burkholderia ambifaria (strain MC40-6) GN=bioF PE=3 SV=1 605 832 8.0E-16
sp|Q0BBD6|BIOF_BURCM 8-amino-7-oxononanoate synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=bioF PE=3 SV=1 605 832 1.0E-15
sp|P36570|BIOF_SERMA 8-amino-7-oxononanoate synthase OS=Serratia marcescens GN=bioF PE=3 SV=1 571 822 1.0E-15
sp|B4E9L6|BIOF_BURCJ 8-amino-7-oxononanoate synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=bioF PE=3 SV=1 597 830 1.0E-15
sp|B1JZD9|BIOF_BURCC 8-amino-7-oxononanoate synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=bioF PE=3 SV=1 596 830 2.0E-15
sp|Q39CE6|BIOF_BURL3 8-amino-7-oxononanoate synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=bioF PE=3 SV=1 586 832 2.0E-15
sp|Q3SLX9|BIOF_THIDA 8-amino-7-oxononanoate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=bioF PE=3 SV=1 566 792 5.0E-15
sp|A7N6R9|CQSA_VIBCB CAI-1 autoinducer synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cqsA PE=1 SV=2 654 860 1.0E-14
sp|B2FLM5|BIOF_STRMK 8-amino-7-oxononanoate synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=bioF PE=3 SV=1 595 832 3.0E-14
sp|B4SM82|BIOF_STRM5 8-amino-7-oxononanoate synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=bioF PE=3 SV=1 595 832 5.0E-14
sp|Q9KM65|CQSA_VIBCH CAI-1 autoinducer synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cqsA PE=1 SV=1 654 828 5.0E-14
sp|Q477A3|BIOF_CUPPJ 8-amino-7-oxononanoate synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=bioF PE=3 SV=1 605 862 7.0E-13
sp|Q6GJB8|PPAT_STAAR Putative pyridoxal phosphate-dependent acyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0555 PE=3 SV=1 924 1022 9.0E-09
sp|A9BGL0|BIOF_PETMO 8-amino-7-oxononanoate synthase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=Pmob_1549 PE=3 SV=1 917 1020 7.0E-07
sp|Q5SHZ8|BIKB_THET8 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA1582 PE=1 SV=1 909 1022 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0030170 pyridoxal phosphate binding Yes
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0070279 vitamin B6 binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0019842 vitamin binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115350
MTRYSYLDLINLCDNVHIPVNGHGQATGFDAERLVPLYLTESVESAIIGLLRPVIIEQLKIENDQSKEMGREALW
DIRVEEDQYRMLKSGRVGPSVHFARWCDTPGKRTEAMRELCERWRDTGLFDDVCGLRKWRNEKYAVYADPFGRHD
YPDEGKEEREMNFVFEMERSACALFGVVTYGVHMSIYGEGVDGEGKRELRVWVPTRAKTKQTFPGLLDNTVAGGI
ASGMGVFESLTKECMEEASLEAEVVKKYARAAGAVSYFYRTSKGWLQPEIEYVYDIAMPGDVDPRIFTPNPLDGE
VESFELMKQDMVIEKLRAGAFKPNCGLVLIDLFVRLGYIVPDDEGDYMEITSRLHGRFRYEFWTEMSSTPQPSSP
MALSKPSFLRKRKSQSLATTMPSAASYLSALSQADARARSHHHPHVRSPSSTPALSISSSLTASSDETAFNEDDD
NTDGLSLPTRPPTSEQVFSTVHTEFGHCADGRYRLTSAHVAGTEVPAHVEHDPPYYILFSTYISYLILICLGHVR
DFVGKRFYPSAYTHLIPKDGYAPLNSDFDSFYTRRLKTRLDECFSQPTTGVAGRTIVLLDRASPDYNHTQYFTGN
RTRALNISSYNYLGFAQARGGCADAVEESIKRYGISTCGTRLAGGTSDLHSIGEALVAKFVGMEDALISSMGFAT
NSTFIPALVGKGCLVISDELNHASIRFGVRLSGANVRMFKHNDMKSLESLLREVISQGQPKTHRPWKKILLIVEG
LYSMEGTMVNLPAVMELKKKYKFYLFVDEAHSIGALGPNGRGVADYFGINPRSIDILMGTFTKSFGAAGGYIAGN
KQLIDRMRLHGHAGAYAESMTPAVLTQVIASMASIMGLALPPMLPSSSATTLRLSSANSTSMEEEYSHPGPVPPT
ALPSWLTLPPALASGAEGSNRLRRLAFNSRYLHNGLDKLGFITYGHPSSPIVPLLLFNPGKMNMFHRMMKDRQTP
IVVVVVAYPATPLVTSRVRFCVSAAHTKEDVDTVLRACDEIGDILDLKHGVKKSERWGVDEICERAVEIAGM*
Coding >AgabiH97|115350
ATGACCCGATACTCCTATCTGGACCTCATCAATCTCTGCGATAATGTGCATATCCCAGTTAATGGACATGGACAG
GCAACAGGATTTGATGCCGAGAGACTTGTACCATTATATCTAACAGAATCAGTGGAGAGCGCTATCATTGGATTA
CTGCGACCTGTGATAATCGAACAATTGAAGATTGAAAATGATCAAAGCAAAGAAATGGGTAGAGAAGCGTTGTGG
GATATTCGAGTAGAGGAAGATCAGTATAGGATGTTGAAGAGTGGGAGGGTGGGGCCGAGTGTTCATTTCGCGAGA
TGGTGTGATACACCGGGTAAAAGGACAGAAGCGATGAGAGAATTATGTGAAAGGTGGAGGGATACGGGATTGTTT
GATGATGTGTGTGGGTTGAGAAAATGGAGAAATGAAAAGTATGCGGTGTATGCGGATCCGTTTGGGAGACATGAT
TATCCGGATGAGGGAAAGGAGGAGAGGGAGATGAATTTTGTGTTTGAGATGGAGAGGTCTGCATGTGCGTTGTTT
GGGGTGGTGACTTATGGAGTGCATATGAGCATCTATGGGGAGGGAGTGGATGGAGAGGGAAAGCGAGAGCTCCGT
GTCTGGGTGCCTACGAGGGCCAAGACCAAACAGACATTCCCCGGATTGCTGGATAACACTGTGGCTGGGGGAATC
GCGAGTGGAATGGGTGTGTTTGAGTCACTGACGAAGGAATGCATGGAAGAGGCGAGTCTGGAGGCAGAGGTGGTA
AAGAAGTATGCTCGAGCAGCAGGAGCAGTCAGTTATTTTTACAGAACGTCGAAAGGCTGGCTGCAGCCCGAAATA
GAATATGTGTACGACATTGCGATGCCCGGAGACGTTGATCCCAGGATATTTACACCTAACCCGCTCGATGGAGAG
GTTGAGTCGTTCGAGCTGATGAAGCAAGACATGGTGATCGAGAAGCTCCGCGCTGGAGCGTTCAAGCCCAACTGT
GGCCTTGTTCTGATAGACCTGTTCGTGCGACTGGGATACATTGTGCCTGACGACGAGGGAGACTACATGGAGATT
ACGAGTCGACTGCATGGGCGGTTTAGATATGAATTTTGGACTGAGATGAGCAGCACCCCTCAGCCTTCGTCCCCC
ATGGCCCTCTCCAAGCCCTCCTTCCTCAGGAAGCGCAAGTCCCAGTCGCTCGCCACCACCATGCCCTCCGCCGCC
TCCTACCTCAGCGCACTCAGCCAGGCAGATGCCCGTGCTCGTAGTCACCACCACCCCCATGTCCGCTCTCCCTCC
TCCACCCCCGCACTCTCCATCTCCTCCTCTCTCACCGCCTCGTCCGACGAAACCGCCTTTAACGAGGATGACGAC
AACACCGACGGTCTCTCCCTCCCCACCCGGCCTCCAACCTCGGAACAGGTCTTTTCCACTGTCCACACAGAGTTT
GGCCACTGCGCCGACGGCAGGTATCGACTCACCTCGGCTCATGTTGCTGGCACCGAGGTCCCTGCACACGTTGAG
CATGACCCCCCCTACTATATTCTTTTCTCTACCTACATTAGCTACCTCATCCTCATCTGCCTCGGTCACGTCCGC
GACTTTGTCGGAAAACGCTTCTATCCCTCGGCCTATACTCACTTGATACCTAAAGATGGCTACGCACCCCTCAAC
TCAGACTTTGATTCGTTCTATACCCGCCGCCTCAAAACACGTCTCGACGAGTGCTTCTCCCAGCCCACCACCGGA
GTCGCTGGCCGCACCATCGTTCTCCTAGACCGTGCCTCCCCCGACTACAACCACACTCAATATTTCACTGGCAAC
CGCACCCGTGCCCTCAACATCTCTTCCTACAACTATCTCGGCTTTGCTCAGGCCCGCGGAGGGTGTGCTGATGCC
GTGGAAGAGTCCATCAAACGCTATGGCATCTCCACCTGTGGTACTAGGCTTGCCGGTGGTACCAGTGACCTGCAC
AGCATTGGCGAGGCGCTCGTCGCCAAATTCGTCGGCATGGAAGATGCTCTCATCAGTTCTATGGGTTTTGCCACT
AATTCGACTTTCATTCCTGCCCTTGTTGGAAAAGGTTGTCTCGTGATCTCGGATGAGCTCAACCACGCTTCTATC
CGTTTCGGAGTCAGGCTTAGCGGTGCAAACGTCAGGATGTTCAAGCATAATGACATGAAGAGCCTCGAGTCGTTG
CTCCGAGAAGTCATCAGTCAGGGACAACCCAAGACTCATCGTCCATGGAAAAAGATTCTTCTCATCGTTGAGGGT
CTTTACTCGATGGAAGGTACCATGGTTAATCTCCCCGCTGTCATGGAACTCAAGAAGAAATACAAATTCTACCTC
TTTGTCGACGAGGCCCATTCCATCGGTGCCCTTGGACCTAATGGACGTGGTGTTGCAGACTATTTTGGTATCAAC
CCCAGGTCAATCGACATTTTGATGGGCACGTTTACAAAATCATTTGGCGCTGCCGGTGGCTATATTGCAGGAAAC
AAACAACTCATCGATCGTATGAGGTTACATGGCCATGCGGGTGCATATGCAGAATCAATGACTCCCGCCGTTCTG
ACGCAAGTCATCGCTAGTATGGCCAGTATCATGGGATTGGCACTTCCACCTATGTTACCTTCGTCGTCGGCTACG
ACTCTCCGGCTTTCCTCCGCCAATAGTACTAGTATGGAAGAAGAGTATTCTCACCCTGGCCCTGTACCTCCTACT
GCTCTTCCCTCGTGGCTTACGCTTCCCCCGGCACTTGCCTCTGGAGCTGAAGGATCAAATCGGTTACGACGCCTT
GCGTTCAACTCTCGCTACCTCCATAATGGTCTTGACAAACTTGGATTCATCACTTATGGACATCCCTCTTCACCG
ATCGTACCACTTTTGTTATTCAACCCTGGAAAGATGAATATGTTTCATAGGATGATGAAAGATCGACAGACACCG
ATTGTGGTGGTGGTGGTGGCGTATCCTGCGACACCGTTGGTGACGAGTAGGGTTAGGTTTTGTGTGAGTGCGGCG
CATACGAAGGAGGATGTGGATACGGTGTTGAGGGCGTGTGATGAGATTGGGGATATTTTGGATTTGAAACATGGG
GTTAAGAAGAGTGAGAGGTGGGGTGTGGATGAGATTTGTGAGAGGGCTGTGGAGATTGCTGGGATGTAG
Transcript >AgabiH97|115350
ATGACCCGATACTCCTATCTGGACCTCATCAATCTCTGCGATAATGTGCATATCCCAGTTAATGGACATGGACAG
GCAACAGGATTTGATGCCGAGAGACTTGTACCATTATATCTAACAGAATCAGTGGAGAGCGCTATCATTGGATTA
CTGCGACCTGTGATAATCGAACAATTGAAGATTGAAAATGATCAAAGCAAAGAAATGGGTAGAGAAGCGTTGTGG
GATATTCGAGTAGAGGAAGATCAGTATAGGATGTTGAAGAGTGGGAGGGTGGGGCCGAGTGTTCATTTCGCGAGA
TGGTGTGATACACCGGGTAAAAGGACAGAAGCGATGAGAGAATTATGTGAAAGGTGGAGGGATACGGGATTGTTT
GATGATGTGTGTGGGTTGAGAAAATGGAGAAATGAAAAGTATGCGGTGTATGCGGATCCGTTTGGGAGACATGAT
TATCCGGATGAGGGAAAGGAGGAGAGGGAGATGAATTTTGTGTTTGAGATGGAGAGGTCTGCATGTGCGTTGTTT
GGGGTGGTGACTTATGGAGTGCATATGAGCATCTATGGGGAGGGAGTGGATGGAGAGGGAAAGCGAGAGCTCCGT
GTCTGGGTGCCTACGAGGGCCAAGACCAAACAGACATTCCCCGGATTGCTGGATAACACTGTGGCTGGGGGAATC
GCGAGTGGAATGGGTGTGTTTGAGTCACTGACGAAGGAATGCATGGAAGAGGCGAGTCTGGAGGCAGAGGTGGTA
AAGAAGTATGCTCGAGCAGCAGGAGCAGTCAGTTATTTTTACAGAACGTCGAAAGGCTGGCTGCAGCCCGAAATA
GAATATGTGTACGACATTGCGATGCCCGGAGACGTTGATCCCAGGATATTTACACCTAACCCGCTCGATGGAGAG
GTTGAGTCGTTCGAGCTGATGAAGCAAGACATGGTGATCGAGAAGCTCCGCGCTGGAGCGTTCAAGCCCAACTGT
GGCCTTGTTCTGATAGACCTGTTCGTGCGACTGGGATACATTGTGCCTGACGACGAGGGAGACTACATGGAGATT
ACGAGTCGACTGCATGGGCGGTTTAGATATGAATTTTGGACTGAGATGAGCAGCACCCCTCAGCCTTCGTCCCCC
ATGGCCCTCTCCAAGCCCTCCTTCCTCAGGAAGCGCAAGTCCCAGTCGCTCGCCACCACCATGCCCTCCGCCGCC
TCCTACCTCAGCGCACTCAGCCAGGCAGATGCCCGTGCTCGTAGTCACCACCACCCCCATGTCCGCTCTCCCTCC
TCCACCCCCGCACTCTCCATCTCCTCCTCTCTCACCGCCTCGTCCGACGAAACCGCCTTTAACGAGGATGACGAC
AACACCGACGGTCTCTCCCTCCCCACCCGGCCTCCAACCTCGGAACAGGTCTTTTCCACTGTCCACACAGAGTTT
GGCCACTGCGCCGACGGCAGGTATCGACTCACCTCGGCTCATGTTGCTGGCACCGAGGTCCCTGCACACGTTGAG
CATGACCCCCCCTACTATATTCTTTTCTCTACCTACATTAGCTACCTCATCCTCATCTGCCTCGGTCACGTCCGC
GACTTTGTCGGAAAACGCTTCTATCCCTCGGCCTATACTCACTTGATACCTAAAGATGGCTACGCACCCCTCAAC
TCAGACTTTGATTCGTTCTATACCCGCCGCCTCAAAACACGTCTCGACGAGTGCTTCTCCCAGCCCACCACCGGA
GTCGCTGGCCGCACCATCGTTCTCCTAGACCGTGCCTCCCCCGACTACAACCACACTCAATATTTCACTGGCAAC
CGCACCCGTGCCCTCAACATCTCTTCCTACAACTATCTCGGCTTTGCTCAGGCCCGCGGAGGGTGTGCTGATGCC
GTGGAAGAGTCCATCAAACGCTATGGCATCTCCACCTGTGGTACTAGGCTTGCCGGTGGTACCAGTGACCTGCAC
AGCATTGGCGAGGCGCTCGTCGCCAAATTCGTCGGCATGGAAGATGCTCTCATCAGTTCTATGGGTTTTGCCACT
AATTCGACTTTCATTCCTGCCCTTGTTGGAAAAGGTTGTCTCGTGATCTCGGATGAGCTCAACCACGCTTCTATC
CGTTTCGGAGTCAGGCTTAGCGGTGCAAACGTCAGGATGTTCAAGCATAATGACATGAAGAGCCTCGAGTCGTTG
CTCCGAGAAGTCATCAGTCAGGGACAACCCAAGACTCATCGTCCATGGAAAAAGATTCTTCTCATCGTTGAGGGT
CTTTACTCGATGGAAGGTACCATGGTTAATCTCCCCGCTGTCATGGAACTCAAGAAGAAATACAAATTCTACCTC
TTTGTCGACGAGGCCCATTCCATCGGTGCCCTTGGACCTAATGGACGTGGTGTTGCAGACTATTTTGGTATCAAC
CCCAGGTCAATCGACATTTTGATGGGCACGTTTACAAAATCATTTGGCGCTGCCGGTGGCTATATTGCAGGAAAC
AAACAACTCATCGATCGTATGAGGTTACATGGCCATGCGGGTGCATATGCAGAATCAATGACTCCCGCCGTTCTG
ACGCAAGTCATCGCTAGTATGGCCAGTATCATGGGATTGGCACTTCCACCTATGTTACCTTCGTCGTCGGCTACG
ACTCTCCGGCTTTCCTCCGCCAATAGTACTAGTATGGAAGAAGAGTATTCTCACCCTGGCCCTGTACCTCCTACT
GCTCTTCCCTCGTGGCTTACGCTTCCCCCGGCACTTGCCTCTGGAGCTGAAGGATCAAATCGGTTACGACGCCTT
GCGTTCAACTCTCGCTACCTCCATAATGGTCTTGACAAACTTGGATTCATCACTTATGGACATCCCTCTTCACCG
ATCGTACCACTTTTGTTATTCAACCCTGGAAAGATGAATATGTTTCATAGGATGATGAAAGATCGACAGACACCG
ATTGTGGTGGTGGTGGTGGCGTATCCTGCGACACCGTTGGTGACGAGTAGGGTTAGGTTTTGTGTGAGTGCGGCG
CATACGAAGGAGGATGTGGATACGGTGTTGAGGGCGTGTGATGAGATTGGGGATATTTTGGATTTGAAACATGGG
GTTAAGAAGAGTGAGAGGTGGGGTGTGGATGAGATTTGTGAGAGGGCTGTGGAGATTGCTGGGATGTAG
Gene >AgabiH97|115350
ATGACCCGATACTCCTATCTGGACCTCATCAATCTCTGCGATAATGTGCATATCCCAGTTAATGGACATGGACAG
GCAACAGGATTTGATGCCGAGAGACTTGTACCATTATATCTAACAGAATCAGTGGAGAGCGCTATCATTGGATTA
CTGCGACCTGTGATAATCGAACAATTGAAGATTGAAAATGATCAAAGCAAAGAAATGGGTAGAGAAGCGTTGTGG
GATATTCGAGTAGAGGAAGATCAGTATAGGATGTTGAAGAGTGGGAGGGTGGGGCCGAGTGTTCATTTCGCGAGA
TGGTGTGATACACCGGGTAAAAGGACAGAAGCGATGAGAGAATTATGTGAAAGGTGGAGGGATACGGGATTGTTT
GATGATGTGTGTGGGTTGAGAAAATGGAGAAATGAAAAGTATGCGGTGTATGCGGATCCGTTTGGGAGACATGAT
TATCCGGATGAGGGAAAGGAGGAGAGGGAGATGAATTTTGTGTTTGAGATGGAGAGGTCTGCATGTGCGTTGTTT
GGGGTGGTGACTTATGGAGTGCATATGAGCATCTATGGGGAGGGAGTGGATGGAGAGGGAAAGCGAGAGCTCCGT
GTCTGGGTGCCTACGAGGGCCAAGACCAAACAGACGTAGGTTATCTGAGTTGATATGAGGGCTTGGCAGTTGATG
ATGATGAGCAGATTCCCCGGATTGCTGGATAACACTGTGGCTGGGGGAATCGCGAGTGGAATGGGTGTGTTTGAG
TCACTGACGAAGGAATGCATGGAAGAGGCGAGTCTGGAGGCAGAGGTGGTAAAGAAGTATGCTCGAGCAGCAGGA
GCAGTCAGTTATTTTTACAGGTGAGTGAATCCAGTGTTAACAAGTTCAGGCAATCATCACTATTAGAACGTCGAA
AGGCTGGCTGCAGCCCGAAATAGAATATGTGTACGACATTGCGATGCCCGGAGACGTTGATCCCAGGATATTTAC
ACCTAACCCGCTCGATGGAGAGGTTGAGTCGTTCGAGGTGAGCAGGAGCGACTGACACAGAAATTGTAAATAATA
TGTTGCAGCTGATGAAGCAAGACATGGTGATCGAGAAGCTCCGCGCTGGAGCGTTCAAGCCCAACTGTGGCCTTG
GTGCGTTGCTAGCTGATGCACGCCATGCCGCTGACGTCGGTGCTGGCTAGTTCTGATAGACCTGTTCGTGCGACT
GGGATACATTGTGCCTGACGACGAGGGAGACTACATGGAGATTACGAGTCGACTGCATGGGCGGTTTAGATATGA
ATTTTGGTAGTTAAGACATTCTTTAGGGGTGTGGGAACGGAGCGGTCTACCCTGCGCAAGCGAGTTGCTCGCTGC
TCCGTTGTGAACGACTATTAGGACTGAGATGAGCAGCACCCCTCAGCCTTCGTCCCCCATGGCCCTCTCCAAGCC
CTCCTTCCTCAGGAAGCGCAAGTCCCAGTCGCTCGCCACCACCATGCCCTCCGCCGCCTCCTACCTCAGCGCACT
CAGCCAGGCAGATGCCCGTGCTCGTAGTCACCACCACCCCCATGTCCGCTCTCCCTCCTCCACCCCCGCACTCTC
CATCTCCTCCTCTCTCACCGCCTCGTCCGACGAAACCGCCTTTAACGAGGATGACGACAACACCGACGGTCTCTC
CCTCCCCACCCGGCCTCCAACCTCGGAACAGGTCTTTTCCACTGTCCACACAGAGTTTGGCCACTGCGCCGACGG
CAGGTATCGACTCACCTCGGCTCATGTTGCTGGCACCGAGGTCCCTGCACACGTTGAGCATGACCCCCCCTACTA
TATTCTTTTCTCTACCTACATTAGCTACCTCATCCTCATCTGCCTCGGTCACGTCCGCGACTTTGTCGGAAAACG
CTTCTATCCCTCGGCCTATACTCACTTGATACCTAAAGATGTACGTCTTCTTTCCCTCTTGGGGGGGTTTTTTTT
TTTTTGACTGCTTCATCCCAGGGCTACGCACCCCTCAACTCAGACTTTGATTCGTTCTATACCCGCCGCCTCAAA
ACACGTCTCGACGAGTGCTTCTCCCAGCCCACCACCGGAGTCGCTGGCCGCACCATCGTTCTCCTAGACCGTGCC
TCCCCCGACTACAACCACACTCAATATTTCACTGGCAACCGCACCCGTGCCCTCAACATCTCTTCCTACAACTAT
CTCGGCTTTGCTCAGGCCCGCGGAGGGTGTGCTGATGCCGTGGAAGAGTCCATCAAACGCTATGGCATCTCCACC
TGTGGTACTAGGCTTGCCGGTGGTACCAGTGACCTGCACAGCATTGGCGAGGCGCTCGTCGCCAAATTCGTCGGC
ATGGAAGATGCTCTCATCAGTTCTATGGGTTTTGCCACTAATTCGACTTTCATTCCTGCCCTTGTTGGAAAAGGT
TGTCTCGTGATCTCGGATGAGCTCAACCACGCTTCTATCCGTTTCGGAGTCAGGCTTAGCGGTGCAAACGTCAGG
ATGTTCAAGCATAATGACATGAAGAGCCTCGAGTCGTTGCTCCGAGAAGTCATCAGTCAGGGACAACCCAAGACT
CATCGTCCATGGAAAAAGATTCTTCTCATCGTTGAGGGTCTTTACTCGATGGAAGGTACCATGGTTAATCTCCCC
GCTGTCATGGAACTCAAGAAGAAATACAAAGTAAGGCATTTAATCACATGTAGTGATATCCGCTAATCTCCATTG
TTCAGTTCTACCTCTTTGTCGACGAGGCCCATTCCATCGGTGCCCTTGGACCTAATGGACGTGGTGTTGCAGACT
ATTTTGGTATCAACCCCAGGTCAATCGACATTTTGATGGGCACGTTTACAAAATCATTTGGCGCTGCCGGTGGCT
ATATTGCAGGAAACAAACAACTCATCGATCGTATGAGGTTACATGGCCATGCGGGTGCATATGCAGAATCAATGA
CTCCCGCCGTTCTGACGCAAGTCATCGCTAGTATGGCCAGTATCATGGGATTGGCACTTCCACCTATGTTACCTT
CGTCGTCGGCTACGACTCTCCGGCTTTCCTCCGCCAATAGTACTAGTATGGAAGAAGAGTATTCTCACCCTGGCC
CTGTACCTCCTACTGCTCTTCCCTCGTGGCTTACGCTTCCCCCGGCACTTGCCTCTGGAGCTGAAGGATCAAATC
GGTTACGACGCCTTGCGTTCAACTCTCGCTACCTCCATAATGGTCTTGACAAACTTGGATTCATCACTTATGGAC
ATCCCTCTTCACCGATCGTACCACTTTTGTTATTCAACCCTGGAAAGATGAATATGTTTCATAGGATGATGAAAG
ATCGACAGACACCGATTGTGGTGGTGGTGGTGGCGTATCCTGCGACACCGTTGGTGACGAGTAGGGTTAGGTTTT
GTGTGAGTGCGGCGCATACGAAGGAGGATGTGGATACGGTGTTGAGGGCGTGTGATGAGATTGGGGATATTTTGG
ATTTGAAACATGGGGTTAAGAAGAGTGAGAGGTGGGGTGTGGATGAGATTTGTGAGAGGGCTGTGGAGATTGCTG
GGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail