Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115250
Gene name
Locationscaffold_9:430030..433909
Strand+
Gene length (bp)3879
Transcript length (bp)3393
Coding sequence length (bp)3393
Protein length (aa) 1131

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03439 Spt5-NGN Early transcription elongation factor of RNA pol II, NGN section 9.8E-22 180 264
PF11942 Spt5_N Spt5 transcription elongation factor, acidic N-terminal 5.1E-18 84 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CR71|SPT5_CRYNB Transcription elongation factor SPT5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SPT5 PE=3 SV=1 137 1000 0.0E+00
sp|P0CR70|SPT5_CRYNJ Transcription elongation factor SPT5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPT5 PE=3 SV=1 137 1000 0.0E+00
sp|O13936|SPT5_SCHPO Transcription elongation factor spt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt5 PE=1 SV=1 107 930 0.0E+00
sp|Q4PIC4|SPT5_USTMA Transcription elongation factor SPT5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SPT5 PE=3 SV=2 114 863 0.0E+00
sp|Q4WP96|SPT5_ASPFU Transcription elongation factor spt5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spt5 PE=3 SV=1 64 958 4.0E-172
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CR71|SPT5_CRYNB Transcription elongation factor SPT5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SPT5 PE=3 SV=1 137 1000 0.0E+00
sp|P0CR70|SPT5_CRYNJ Transcription elongation factor SPT5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPT5 PE=3 SV=1 137 1000 0.0E+00
sp|O13936|SPT5_SCHPO Transcription elongation factor spt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt5 PE=1 SV=1 107 930 0.0E+00
sp|Q4PIC4|SPT5_USTMA Transcription elongation factor SPT5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SPT5 PE=3 SV=2 114 863 0.0E+00
sp|Q4WP96|SPT5_ASPFU Transcription elongation factor spt5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spt5 PE=3 SV=1 64 958 4.0E-172
sp|Q2UGU3|SPT5_ASPOR Transcription elongation factor spt5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=spt5 PE=3 SV=1 125 958 3.0E-166
sp|Q5BCN2|SPT5_EMENI Transcription elongation factor spt5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spt5 PE=3 SV=1 124 976 8.0E-162
sp|Q6CC84|SPT5_YARLI Transcription elongation factor SPT5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPT5 PE=3 SV=1 1 974 1.0E-161
sp|Q7S3C4|SPT5_NEUCR Transcription elongation factor spt5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trf-3 PE=3 SV=3 126 976 9.0E-154
sp|Q4I5I4|SPT5_GIBZE Transcription elongation factor SPT5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPT5 PE=3 SV=1 142 967 8.0E-152
sp|O55201|SPT5H_MOUSE Transcription elongation factor SPT5 OS=Mus musculus GN=Supt5h PE=1 SV=1 96 1106 4.0E-122
sp|O00267|SPT5H_HUMAN Transcription elongation factor SPT5 OS=Homo sapiens GN=SUPT5H PE=1 SV=1 96 1106 9.0E-121
sp|Q5R405|SPT5H_PONAB Transcription elongation factor SPT5 OS=Pongo abelii GN=SUPT5H PE=2 SV=1 113 1108 1.0E-120
sp|Q6BZG0|SPT5_DEBHA Transcription elongation factor SPT5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPT5 PE=3 SV=2 104 898 2.0E-120
sp|P27692|SPT5_YEAST Transcription elongation factor SPT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT5 PE=1 SV=1 75 911 2.0E-119
sp|Q6FRZ5|SPT5_CANGA Transcription elongation factor SPT5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SPT5 PE=3 SV=1 75 905 7.0E-119
sp|Q5ZI08|SPT5H_CHICK Transcription elongation factor SPT5 OS=Gallus gallus GN=SUPT5H PE=2 SV=1 96 1106 3.0E-118
sp|Q9DDT5|SPT5H_DANRE Transcription elongation factor SPT5 OS=Danio rerio GN=supt5h PE=1 SV=1 165 1106 9.0E-114
sp|Q759T6|SPT5_ASHGO Transcription elongation factor SPT5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SPT5 PE=3 SV=2 74 901 5.0E-112
sp|Q6CWW9|SPT5_KLULA Transcription elongation factor SPT5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPT5 PE=3 SV=1 75 911 8.0E-111
sp|Q5ALX3|SPT5_CANAL Transcription elongation factor SPT5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPT5 PE=3 SV=1 72 851 3.0E-107
sp|Q759T6|SPT5_ASHGO Transcription elongation factor SPT5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SPT5 PE=3 SV=2 125 905 6.0E-106
sp|Q21338|SPT5H_CAEEL Transcription elongation factor SPT5 OS=Caenorhabditis elegans GN=spt-5 PE=3 SV=3 164 980 3.0E-90
sp|Q9V460|SPT5H_DROME Transcription elongation factor SPT5 OS=Drosophila melanogaster GN=Spt5 PE=1 SV=1 105 855 6.0E-89
sp|Q9STN3|SPT51_ARATH Putative transcription elongation factor SPT5 homolog 1 OS=Arabidopsis thaliana GN=At4g08350 PE=1 SV=2 65 959 1.0E-82
sp|O80770|SPT52_ARATH Putative transcription elongation factor SPT5 homolog 2 OS=Arabidopsis thaliana GN=At2g34210 PE=3 SV=2 129 881 9.0E-76
sp|F4JW79|RDM3_ARATH Protein RNA-directed DNA methylation 3 OS=Arabidopsis thaliana GN=RDM3 PE=1 SV=1 136 427 1.0E-34
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115250
MSDVEDLNSYDPDMQQPREEEEEEEEEEEESFDKPQKQPTRREFEDEEEEEDEEDEEDEEDEENSGRKRKKAKHR
HRRSAASRFLDIEAEVSDDEEDEDEDEDIGADPFIETGEDMDEDAARGHHASLDARRQLAEEEQSPEEIAKNLSR
RYAHRAAVRYTGDMNEIPQRLLMPSVQDASLWQVRVRPGRERDIVFSIMRKALDVEFTAKPLAILSAFQRDSLPG
MIYVEARSSKQVSEACNGLVGVYLTRIHLVPIEEMASLLQIKKQEQTVTPGSWVRIRRGKYAGDLAQVMDITDTG
EDVGLKFIPRIDLNPRDDAALDGKKRKKMTGSGANMRPPQRLFNYEEVAKVYGRKSVTRRSDVYVFQNDTYRDGF
IEKDFKVSALILEDVNPTLDEITQFTRRQDGEGENPVDLSIIAEASRKAAVLVLQPGDHVEVFEGEQAGIHGVVE
EINQDVVTISAIGFDVEGQKIEIPARSVRKRFKPGDHVKVMTGQNADETGLVVSIADNIVTFLSDMSMQEVSVFS
KDLREAAEVGSGTNIVGNYELHDLVQLDAQTVGVIFKTERDSFRVLDQNGQVRLVQPHQISMRRDSNRAVATDRD
GHEIRINDNMKEVEGEGRKGRVLHIYQSFYAFLHNRDIIENGGVFVTRTRALLSVAPKGSLVKPGADLSKMNPAL
VQPTGGMVGSGNMGRGPKDRHIGVTVTVVKGPHKGYAGTIKDTNGNIARVELRTGNKLIMIDKEKLYRRLPDGKL
EPLDRPGGGRGGGFGPGGGGRMGPPYNAGGFGGNAAGGRTPFGNSGRTPNPYTSTEGRTPGWNASRTPNPYVDGG
KTPAWNASSRTPNPYADGGKTPAWNASSRTPNPYSSGGGASSWGGATPGGNVAPAGGPSWGGATPGRATTGWGTS
DGWASPRNTSWTATDTTPWSAPTPASAPTPASAPTPTTAATPAFNSGPTPAPMHTPAPPLAHTPANYWTGQSAPT
PFTSFTYGTSPSSSEYTLDEDWMFESIASTYLNRIKVIIRDTKIDNYKDGILENRVGFILSAHRTQGGYEQEVVV
AFDDLSGEKETLAAKYVKPIEASRTNEEALAMEGPSEVKGRAVLLRANADSAMVEVSPKGDSSVFEVPKTALLAL
YEQRS*
Coding >AgabiH97|115250
ATGTCGGACGTCGAAGACCTTAATTCGTACGACCCTGATATGCAACAACCCCGAGAGGAGGAGGAGGAGGAAGAA
GAGGAAGAGGAAGAGTCCTTCGATAAGCCGCAGAAACAACCGACGCGGCGGGAATTTGAAGATGAGGAAGAGGAA
GAGGACGAGGAGGATGAAGAAGACGAGGAAGACGAAGAAAACTCTGGAAGGAAACGCAAGAAAGCCAAGCACCGT
CATCGACGTTCGGCTGCTAGTCGTTTCCTAGATATTGAAGCCGAGGTCAGCGACGATGAAGAAGACGAAGACGAA
GATGAAGACATAGGTGCAGATCCTTTCATTGAGACGGGAGAGGATATGGATGAAGATGCGGCAAGAGGCCATCAT
GCTTCACTAGATGCAAGGCGACAACTTGCTGAAGAAGAACAAAGCCCGGAAGAGATTGCAAAAAATCTAAGTAGA
CGATATGCCCATCGCGCCGCCGTTCGATATACGGGTGACATGAATGAAATCCCGCAAAGATTGCTCATGCCTTCA
GTGCAAGATGCAAGTTTATGGCAAGTTCGAGTCAGGCCTGGACGCGAGCGCGATATTGTGTTTAGTATCATGCGC
AAAGCGCTCGATGTCGAGTTTACCGCAAAACCTCTCGCTATCCTTTCTGCTTTCCAAAGAGACTCGCTTCCCGGT
ATGATATACGTGGAAGCACGCAGCTCAAAACAAGTTTCCGAAGCTTGTAATGGTCTCGTTGGTGTCTACCTCACT
CGTATACATCTTGTGCCCATTGAAGAAATGGCCAGCCTTTTGCAAATCAAAAAACAAGAGCAGACCGTGACACCG
GGTAGCTGGGTGCGCATCCGTCGAGGAAAATATGCCGGAGATTTGGCGCAAGTTATGGATATCACCGATACTGGC
GAAGATGTCGGATTGAAGTTCATTCCCCGTATTGATCTCAATCCAAGAGATGATGCTGCTTTGGACGGGAAGAAG
CGGAAAAAAATGACTGGCTCAGGCGCCAACATGCGTCCGCCACAACGACTGTTTAATTATGAGGAGGTCGCAAAG
GTGTATGGCCGCAAGTCTGTGACTCGTCGGAGCGATGTCTACGTATTTCAAAACGACACCTACCGTGATGGGTTC
ATCGAAAAGGATTTCAAAGTCAGCGCTTTGATTCTGGAGGATGTGAATCCGACTTTGGATGAAATCACACAATTC
ACTAGACGGCAGGACGGGGAAGGCGAGAACCCGGTAGATCTTTCGATTATCGCTGAGGCTTCACGCAAAGCTGCT
GTATTGGTTTTACAACCTGGTGATCATGTAGAAGTGTTTGAGGGTGAACAGGCCGGTATCCATGGTGTAGTGGAA
GAGATCAACCAGGATGTGGTGACGATTTCTGCGATTGGATTTGACGTGGAGGGTCAGAAGATCGAAATTCCTGCC
AGGAGTGTGAGGAAGAGGTTCAAACCTGGTGACCATGTCAAGGTCATGACTGGCCAGAATGCCGATGAAACGGGT
TTGGTGGTTTCAATTGCGGATAACATCGTAACGTTTTTGTCGGACATGTCGATGCAAGAGGTCTCTGTGTTCTCT
AAGGATCTTCGTGAAGCTGCCGAGGTTGGCTCAGGTACTAACATTGTTGGAAACTACGAGCTGCACGACTTGGTT
CAACTTGACGCGCAAACTGTTGGTGTCATTTTCAAGACTGAACGCGATTCTTTCCGTGTTCTAGACCAAAACGGC
CAGGTGCGTTTGGTACAACCCCACCAAATCTCTATGCGCCGGGATTCAAACCGAGCGGTGGCGACGGATCGCGAT
GGACACGAGATACGCATCAATGACAACATGAAGGAAGTTGAGGGAGAGGGACGCAAGGGCCGTGTTCTACACATC
TACCAATCCTTCTACGCTTTCCTCCATAACCGCGATATCATTGAAAATGGCGGTGTTTTTGTGACAAGGACACGA
GCCTTGCTCTCCGTGGCACCGAAAGGTAGTCTCGTCAAACCCGGTGCAGATCTTTCGAAGATGAACCCAGCACTC
GTTCAACCCACTGGTGGCATGGTAGGCTCAGGCAATATGGGTCGGGGACCCAAAGACAGGCATATTGGAGTGACA
GTCACCGTAGTCAAGGGACCTCATAAGGGATATGCGGGTACTATCAAAGATACGAACGGCAACATTGCTCGGGTT
GAGCTACGGACGGGGAACAAGCTTATCATGATCGACAAAGAGAAGCTTTACCGCAGGCTGCCCGATGGCAAGCTT
GAACCCCTCGATAGACCAGGAGGCGGACGTGGCGGTGGATTTGGTCCTGGTGGAGGAGGTCGTATGGGGCCCCCA
TACAACGCTGGTGGGTTTGGTGGCAATGCTGCAGGTGGCCGTACGCCCTTCGGCAACTCGGGACGTACACCAAAC
CCTTATACATCCACCGAAGGCCGGACACCCGGATGGAACGCCTCAAGAACGCCAAATCCATATGTTGATGGAGGA
AAGACGCCTGCGTGGAATGCAAGTTCGCGGACGCCTAATCCTTATGCTGATGGTGGTAAAACACCAGCATGGAAC
GCCAGCTCTAGGACACCAAATCCATATAGCAGTGGAGGTGGTGCTTCCAGTTGGGGCGGTGCGACTCCTGGAGGG
AATGTCGCACCTGCCGGGGGTCCGTCATGGGGTGGTGCCACGCCTGGAAGAGCGACCACAGGGTGGGGTACGAGT
GACGGATGGGCGTCACCGAGGAATACTAGTTGGACAGCGACTGACACGACGCCTTGGAGTGCACCTACTCCAGCT
TCTGCACCCACACCAGCTTCTGCACCAACACCCACAACAGCGGCTACGCCAGCGTTCAATAGTGGACCTACACCA
GCACCCATGCATACTCCTGCTCCTCCACTTGCCCATACACCTGCTAACTATTGGACTGGACAATCGGCTCCCACA
CCATTCACAAGCTTCACTTATGGAACAAGTCCCAGCTCATCCGAGTACACACTGGATGAAGATTGGATGTTCGAA
TCTATAGCCTCGACCTATCTCAACCGCATCAAGGTTATAATCCGGGATACCAAGATCGACAACTACAAAGACGGT
ATCCTTGAAAATCGAGTGGGTTTTATTCTTTCAGCGCATCGGACTCAAGGCGGGTATGAACAAGAGGTTGTGGTT
GCATTTGATGACCTGTCTGGAGAAAAAGAGACATTAGCGGCCAAGTATGTCAAACCGATTGAGGCATCGAGAACG
AATGAAGAGGCGTTGGCGATGGAAGGTCCTAGTGAGGTGAAAGGACGTGCTGTGTTATTACGCGCCAATGCGGAT
TCTGCTATGGTGGAAGTGTCGCCGAAAGGTGATTCGAGTGTATTCGAGGTTCCTAAGACGGCTCTGTTGGCTTTG
TATGAGCAGAGAAGTTAG
Transcript >AgabiH97|115250
ATGTCGGACGTCGAAGACCTTAATTCGTACGACCCTGATATGCAACAACCCCGAGAGGAGGAGGAGGAGGAAGAA
GAGGAAGAGGAAGAGTCCTTCGATAAGCCGCAGAAACAACCGACGCGGCGGGAATTTGAAGATGAGGAAGAGGAA
GAGGACGAGGAGGATGAAGAAGACGAGGAAGACGAAGAAAACTCTGGAAGGAAACGCAAGAAAGCCAAGCACCGT
CATCGACGTTCGGCTGCTAGTCGTTTCCTAGATATTGAAGCCGAGGTCAGCGACGATGAAGAAGACGAAGACGAA
GATGAAGACATAGGTGCAGATCCTTTCATTGAGACGGGAGAGGATATGGATGAAGATGCGGCAAGAGGCCATCAT
GCTTCACTAGATGCAAGGCGACAACTTGCTGAAGAAGAACAAAGCCCGGAAGAGATTGCAAAAAATCTAAGTAGA
CGATATGCCCATCGCGCCGCCGTTCGATATACGGGTGACATGAATGAAATCCCGCAAAGATTGCTCATGCCTTCA
GTGCAAGATGCAAGTTTATGGCAAGTTCGAGTCAGGCCTGGACGCGAGCGCGATATTGTGTTTAGTATCATGCGC
AAAGCGCTCGATGTCGAGTTTACCGCAAAACCTCTCGCTATCCTTTCTGCTTTCCAAAGAGACTCGCTTCCCGGT
ATGATATACGTGGAAGCACGCAGCTCAAAACAAGTTTCCGAAGCTTGTAATGGTCTCGTTGGTGTCTACCTCACT
CGTATACATCTTGTGCCCATTGAAGAAATGGCCAGCCTTTTGCAAATCAAAAAACAAGAGCAGACCGTGACACCG
GGTAGCTGGGTGCGCATCCGTCGAGGAAAATATGCCGGAGATTTGGCGCAAGTTATGGATATCACCGATACTGGC
GAAGATGTCGGATTGAAGTTCATTCCCCGTATTGATCTCAATCCAAGAGATGATGCTGCTTTGGACGGGAAGAAG
CGGAAAAAAATGACTGGCTCAGGCGCCAACATGCGTCCGCCACAACGACTGTTTAATTATGAGGAGGTCGCAAAG
GTGTATGGCCGCAAGTCTGTGACTCGTCGGAGCGATGTCTACGTATTTCAAAACGACACCTACCGTGATGGGTTC
ATCGAAAAGGATTTCAAAGTCAGCGCTTTGATTCTGGAGGATGTGAATCCGACTTTGGATGAAATCACACAATTC
ACTAGACGGCAGGACGGGGAAGGCGAGAACCCGGTAGATCTTTCGATTATCGCTGAGGCTTCACGCAAAGCTGCT
GTATTGGTTTTACAACCTGGTGATCATGTAGAAGTGTTTGAGGGTGAACAGGCCGGTATCCATGGTGTAGTGGAA
GAGATCAACCAGGATGTGGTGACGATTTCTGCGATTGGATTTGACGTGGAGGGTCAGAAGATCGAAATTCCTGCC
AGGAGTGTGAGGAAGAGGTTCAAACCTGGTGACCATGTCAAGGTCATGACTGGCCAGAATGCCGATGAAACGGGT
TTGGTGGTTTCAATTGCGGATAACATCGTAACGTTTTTGTCGGACATGTCGATGCAAGAGGTCTCTGTGTTCTCT
AAGGATCTTCGTGAAGCTGCCGAGGTTGGCTCAGGTACTAACATTGTTGGAAACTACGAGCTGCACGACTTGGTT
CAACTTGACGCGCAAACTGTTGGTGTCATTTTCAAGACTGAACGCGATTCTTTCCGTGTTCTAGACCAAAACGGC
CAGGTGCGTTTGGTACAACCCCACCAAATCTCTATGCGCCGGGATTCAAACCGAGCGGTGGCGACGGATCGCGAT
GGACACGAGATACGCATCAATGACAACATGAAGGAAGTTGAGGGAGAGGGACGCAAGGGCCGTGTTCTACACATC
TACCAATCCTTCTACGCTTTCCTCCATAACCGCGATATCATTGAAAATGGCGGTGTTTTTGTGACAAGGACACGA
GCCTTGCTCTCCGTGGCACCGAAAGGTAGTCTCGTCAAACCCGGTGCAGATCTTTCGAAGATGAACCCAGCACTC
GTTCAACCCACTGGTGGCATGGTAGGCTCAGGCAATATGGGTCGGGGACCCAAAGACAGGCATATTGGAGTGACA
GTCACCGTAGTCAAGGGACCTCATAAGGGATATGCGGGTACTATCAAAGATACGAACGGCAACATTGCTCGGGTT
GAGCTACGGACGGGGAACAAGCTTATCATGATCGACAAAGAGAAGCTTTACCGCAGGCTGCCCGATGGCAAGCTT
GAACCCCTCGATAGACCAGGAGGCGGACGTGGCGGTGGATTTGGTCCTGGTGGAGGAGGTCGTATGGGGCCCCCA
TACAACGCTGGTGGGTTTGGTGGCAATGCTGCAGGTGGCCGTACGCCCTTCGGCAACTCGGGACGTACACCAAAC
CCTTATACATCCACCGAAGGCCGGACACCCGGATGGAACGCCTCAAGAACGCCAAATCCATATGTTGATGGAGGA
AAGACGCCTGCGTGGAATGCAAGTTCGCGGACGCCTAATCCTTATGCTGATGGTGGTAAAACACCAGCATGGAAC
GCCAGCTCTAGGACACCAAATCCATATAGCAGTGGAGGTGGTGCTTCCAGTTGGGGCGGTGCGACTCCTGGAGGG
AATGTCGCACCTGCCGGGGGTCCGTCATGGGGTGGTGCCACGCCTGGAAGAGCGACCACAGGGTGGGGTACGAGT
GACGGATGGGCGTCACCGAGGAATACTAGTTGGACAGCGACTGACACGACGCCTTGGAGTGCACCTACTCCAGCT
TCTGCACCCACACCAGCTTCTGCACCAACACCCACAACAGCGGCTACGCCAGCGTTCAATAGTGGACCTACACCA
GCACCCATGCATACTCCTGCTCCTCCACTTGCCCATACACCTGCTAACTATTGGACTGGACAATCGGCTCCCACA
CCATTCACAAGCTTCACTTATGGAACAAGTCCCAGCTCATCCGAGTACACACTGGATGAAGATTGGATGTTCGAA
TCTATAGCCTCGACCTATCTCAACCGCATCAAGGTTATAATCCGGGATACCAAGATCGACAACTACAAAGACGGT
ATCCTTGAAAATCGAGTGGGTTTTATTCTTTCAGCGCATCGGACTCAAGGCGGGTATGAACAAGAGGTTGTGGTT
GCATTTGATGACCTGTCTGGAGAAAAAGAGACATTAGCGGCCAAGTATGTCAAACCGATTGAGGCATCGAGAACG
AATGAAGAGGCGTTGGCGATGGAAGGTCCTAGTGAGGTGAAAGGACGTGCTGTGTTATTACGCGCCAATGCGGAT
TCTGCTATGGTGGAAGTGTCGCCGAAAGGTGATTCGAGTGTATTCGAGGTTCCTAAGACGGCTCTGTTGGCTTTG
TATGAGCAGAGAAGTTAG
Gene >AgabiH97|115250
ATGTCGGACGTCGAAGACCTTAATTCGTACGACCCTGATATGCAACAACCCCGAGAGGAGGAGGAGGAGGAAGAA
GAGGAAGAGGAAGAGTCCTTCGATAAGCCGCAGAAACAACCGACGCGGCGGGAATTTGAAGATGAGGAAGAGGAA
GAGGACGAGGAGGATGAAGAAGACGAGGAAGACGAAGAAAACTCTGGAAGGAAACGCAAGAAAGCCAAGGTATGT
TTATTGATGTACTGCTCTGTTGGTGTAATAGTGGAATTGAAACAATGATGTAGCACCGTCATCGACGTTCGGCTG
CTAGTCGTTTCCTAGATATTGAAGCCGAGGTCAGCGACGATGAAGAAGACGAAGACGAAGATGAAGACATAGGTG
CAGGTGAGTTGTTACGCTGTTTATAAGTTCGAAGTGTACCAATAATGATATAGATCCTTTCATTGAGACGGGAGA
GGATATGGATGAAGATGCGGCAAGAGGCCATCATGCTTCACTAGATGCAAGGCGACAACTTGCTGAAGAAGAACA
AAGCCCGGAAGAGATTGCAAAAAATCTAAGTAGACGATATGCCCATCGCGCCGCCGTTCGATATACGGGTGACAT
GAATGAAATCCCGCAAAGATTGCTCATGCCTTCAGTGCAAGATGCAAGTTTATGGCAAGTTCGAGTCAGGGTGAG
TACCTTACCATTCGTTCATGACCGAGAAAAAGGCTTACATGTGGCTAGCCTGGACGCGAGCGCGATATTGTGTTT
AGTATCATGCGCAAAGCGCTCGATGTCGAGTTTACCGCAAAACCTCTCGCTATCCTTTCTGCTTTCCAAAGAGAC
TCGCTTCCCGGTATGATATACGTGGAAGCACGCAGCTCAAAACAAGTTTCCGAAGCTTGTAATGGTCTCGTTGGT
GTCTACCTCACTCGTATACATCTTGTGCCCATTGAAGAAATGGCCAGCCTTTTGCAAATCAAAAAACAAGAGCAG
ACCGTGACACCGGGTAGCTGGGTGCGCATCCGTCGAGGAAAATATGCCGGAGATTTGGCGCAAGTTATGGATATC
ACCGATACTGGCGAAGATGTCGGATTGAAGTTCATTCCCCGTATTGATCTCAATCCAAGAGATGATGCTGCTTTG
GACGGGAAGAAGCGGAAAAAAATGACTGGCTCAGGCGCCAACATGCGTCCGCCACAACGACTGTTTAATTATGAG
GAGGTCGCAAAGGTGTATGGCCGCAAGTCTGTGACTCGTCGGAGCGATGTCTACGTATTTCAAAACGACACCTAC
CGTGATGGGTTCATCGAAAAGGATTTCAAAGTCAGCGCTTTGATTCTGGAGGATGTGAATCCGACTTTGGATGAA
ATCACACAATTCACTAGACGGCAGGACGGGGAAGGCGAGAACCCGGTAGATCTTTCGATTATCGCTGAGGCTTCA
CGCAAAGCTGCTGTATTGGTTTTACAACCTGGTGATCATGTAGAAGTGTTTGAGGGTGAACAGGCCGGTATCCAT
GGTGTAGTGGAAGAGATCAACCAGGATGTGGTGACGATTTCTGCGATTGGATTTGACGTGGAGGGTCAGAAGATC
GAAATTCCTGCCAGGAGTGTGAGGAAGAGGTTCAAACCTGGTGACCATGTCAAGGTCATGACTGGCCAGAATGCC
GATGAAACGGGTTTGGTGGTTTCAATTGCGGATAACATCGTAACGTTTTTGTCGGACATGTCGATGCAAGAGGTG
AGCGCTGAAAAATATTTTTGGTTGTCGATATTGAATAATAATCTCGTTGTAGGTCTCTGTGTTCTCTAAGGATCT
TCGTGAAGCTGCCGAGGTTGGCTCAGGTACTAACATTGTTGGAAACTACGAGCTGCACGACTTGGTTCAACTTGA
GTATGTAACGACTTAACCCTTCTCCCGATGAATTTCTCATCTTATTTCTGCAGCGCGCAAACTGTTGGTGTCATT
TTCAAGACTGAACGCGATTCTTTCCGTGTTCTAGACCAAAACGGCCAGGTGCGTTTGGTACAACCCCACCAAATC
TCTATGCGCCGGGATTCAAACCGAGCGGTGGCGACGGATCGCGATGGACACGAGATACGCATCAATGACAACATG
AAGGAAGTTGAGGGAGAGGTAAGACTCTACTTCTGGTCTAAATGCAAGTTTCTAATGTGGCCATCAGGGACGCAA
GGGCCGTGTTCTACACATCTACCAATCCTTCTACGCTTTCCTCCATAACCGCGATATCATTGAAAATGGCGGTGT
TTTTGTGACAAGGACACGAGCCTTGCTCTCCGTGGCACCGAAAGGTAGTCTCGTCAAACCCGGTGCAGATCTTTC
GAAGATGAACCCAGCACTCGTTCAACCCACTGGTGGCATGGTAGGCTCAGGCAATATGGGTCGGGGACCCAAAGA
CAGGCATATTGGAGTGACAGTCACCGTAGTCAAGGGACCTCATAAGGGATATGCGGGTACTATCAAAGATACGAA
CGGCAACATTGCTCGGGTTGAGCTACGGACGGGGAACAAGCTTATCATGATCGACAAAGAGAAGCTTTACCGCAG
GCTGTAAGTTATCAGTCATCCATCCTACAAACGTCATGTCCTTATCTTGTATGTTAGGCCCGATGGCAAGCTTGA
ACCCCTCGATAGACCAGGAGGCGGACGTGGCGGTGGATTTGGTCCTGGTGGAGGAGGTCGTATGGGGCCCCCATA
CAACGCTGGTGGGTTTGGTGGCAATGCTGCAGGTGGCCGTACGCCCTTCGGCAACTCGGGACGTACACCAAACCC
TTATACATCCACCGAAGGCCGGACACCCGGATGGAACGCCTCAAGAACGCCAAATCCATATGTTGATGGAGGAAA
GACGCCTGCGTGGAATGCAAGTTCGCGGACGCCTAATCCTTATGCTGATGGTGGTAAAACACCAGCATGGAACGC
CAGCTCTAGGACACCAAATCCATATAGCAGTGGAGGTGGTGCTTCCAGTTGGGGCGGTGCGACTCCTGGAGGGAA
TGTCGCACCTGCCGGGGGTCCGTCATGGGGTGGTGCCACGCCTGGAAGAGCGACCACAGGGTGGGGTACGAGTGA
CGGATGGGCGTCACCGAGGAATACTAGTTGGACAGCGACTGACACGACGCCTTGGGTGAGTTTCTATAGACCATC
GTTTTTTTATTTCGATAAGTTGTTTATTCATTTGGACAGAGTGCACCTACTCCAGCTTCTGCACCCACACCAGCT
TCTGCACCAACACCCACAACAGCGGCTACGCCAGCGTTCAATAGTGGACCTACACCAGCACCCATGCATACTCCT
GCTCCTCCACTTGCCCATACACCTGCTAACTATTGGACTGGACAATCGGCTCCCACACCATTCACAAGCTTCACT
TATGGAACAAGTCCCAGCTCATCCGAGTACAGTACGTCGACCTTTTTCATAAGATATTGACCCATGACTTATTCT
GCTATTTTAGCACTGGATGAAGATTGGATGTTCGAATCTATAGCCTCGACCTATCTCAACCGCATCAAGGTTATA
ATCCGGGATACCAAGATCGACAACTACAAAGACGGTATCCTTGAAAATCGAGTGGGTTTTATTCTTTCAGCGCAT
CGGACTCAAGGCGGGTATGAACAAGAGGTTGTGGTTGCATTTGATGACCTGTCTGGAGAAAAAGAGACATTAGCG
GCCAAGTATGTCAAACCGATTGAGGCATCGAGAACGAATGAAGAGGCGTTGGCGATGGAAGGTCCTAGTGAGGTG
AAAGGACGTGCTGTGTTATTACGCGCCAATGCGGATTCTGCTATGGTGGAAGTGTCGCCGAAAGGTGATTCGAGT
GTATTCGAGGTTCCTAAGACGGCTCTGTTGGCTTTGTATGAGCAGAGAAGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail