Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|115030
Gene name
Locationscaffold_9:381674..384724
Strand+
Gene length (bp)3050
Transcript length (bp)2679
Coding sequence length (bp)2679
Protein length (aa) 893

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 6.0E-05 86 121
PF00400 WD40 WD domain, G-beta repeat 3.0E-03 150 185
PF05783 DLIC Dynein light intermediate chain (DLIC) 6.2E-05 714 825

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13985|YEG3_SCHPO Uncharacterized WD repeat-containing protein C26H5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.03 PE=1 SV=2 1 496 8.0E-56
sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo sapiens GN=CHAF1B PE=1 SV=1 1 236 3.0E-43
sp|Q5R1S9|CAF1B_CHICK Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 1 250 4.0E-43
sp|Q04199|CAC2_YEAST Chromatin assembly factor 1 subunit p60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAC2 PE=1 SV=1 6 229 7.0E-41
sp|Q9D0N7|CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus GN=Chaf1b PE=1 SV=1 1 236 3.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13985|YEG3_SCHPO Uncharacterized WD repeat-containing protein C26H5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.03 PE=1 SV=2 1 496 8.0E-56
sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo sapiens GN=CHAF1B PE=1 SV=1 1 236 3.0E-43
sp|Q5R1S9|CAF1B_CHICK Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 1 250 4.0E-43
sp|Q04199|CAC2_YEAST Chromatin assembly factor 1 subunit p60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAC2 PE=1 SV=1 6 229 7.0E-41
sp|Q9D0N7|CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus GN=Chaf1b PE=1 SV=1 1 236 3.0E-39
sp|Q9SXY1|FAS2_ARATH Chromatin assembly factor 1 subunit FAS2 OS=Arabidopsis thaliana GN=FAS2 PE=1 SV=1 1 279 1.0E-32
sp|Q6ZD63|FAS2_ORYSJ Chromatin assembly factor 1 subunit FAS2 homolog OS=Oryza sativa subsp. japonica GN=FAS2 PE=2 SV=1 1 275 4.0E-32
sp|Q32SG6|HIRA_MAIZE Protein HIRA OS=Zea mays PE=1 SV=1 45 230 7.0E-28
sp|Q652L2|HIRA_ORYSJ Protein HIRA OS=Oryza sativa subsp. japonica GN=Os09g0567700 PE=2 SV=1 45 230 1.0E-26
sp|Q9LXN4|HIRA_ARATH Protein HIRA OS=Arabidopsis thaliana GN=HIRA PE=1 SV=2 45 230 5.0E-24
sp|Q6CXX3|HIR1_KLULA Protein HIR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIR1 PE=3 SV=1 11 267 2.0E-23
sp|P32479|HIR1_YEAST Protein HIR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIR1 PE=1 SV=3 45 228 2.0E-23
sp|P79987|HIRA_CHICK Protein HIRA OS=Gallus gallus GN=HIRA PE=1 SV=2 11 228 4.0E-23
sp|O17468|HIRA_DROME Protein HIRA homolog OS=Drosophila melanogaster GN=Hira PE=1 SV=2 45 227 2.0E-22
sp|O42611|HIRA_TAKRU Protein HIRA OS=Takifugu rubripes GN=hira PE=2 SV=1 11 228 5.0E-22
sp|Q8QFR2|HIRA_XENLA Protein HIRA OS=Xenopus laevis GN=hira PE=1 SV=2 11 228 1.0E-21
sp|Q6FVD3|HIR1_CANGA Protein HIR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HIR1 PE=3 SV=1 45 228 1.0E-21
sp|P0CS38|HIR1_CRYNJ Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HIR1 PE=3 SV=1 45 227 1.0E-21
sp|P0CS39|HIR1_CRYNB Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HIR1 PE=3 SV=1 45 227 1.0E-21
sp|Q61666|HIRA_MOUSE Protein HIRA OS=Mus musculus GN=Hira PE=1 SV=3 11 228 4.0E-21
sp|P54198|HIRA_HUMAN Protein HIRA OS=Homo sapiens GN=HIRA PE=1 SV=2 11 228 5.0E-21
sp|Q86HX1|HIRA_DICDI Protein HIRA OS=Dictyostelium discoideum GN=hira PE=3 SV=1 45 230 8.0E-21
sp|Q7RZI0|HIR1_NEUCR Protein hir-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hir-1 PE=3 SV=2 45 228 2.0E-20
sp|Q6C553|HIR1_YARLI Protein HIR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HIR1 PE=3 SV=2 45 228 1.0E-19
sp|Q2GSJ9|HIR1_CHAGB Protein HIR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HIR1 PE=3 SV=1 45 230 2.0E-19
sp|Q6BYU4|HIR1_DEBHA Protein HIR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HIR1 PE=3 SV=2 45 232 2.0E-19
sp|Q4IBR4|HIR1_GIBZE Protein HIR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HIR1 PE=3 SV=1 45 231 1.0E-18
sp|Q4P4R3|HIR1_USTMA Protein HIR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HIR1 PE=3 SV=1 43 230 1.0E-18
sp|Q5ACW8|HIR1_CANAL Protein HIR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HIR1 PE=3 SV=1 67 239 2.0E-18
sp|Q2UBU2|HIR1_ASPOR Protein HIR1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=HIR1 PE=3 SV=1 45 231 4.0E-18
sp|P87314|HIR1_SCHPO Protein hir1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hip1 PE=1 SV=1 45 230 1.0E-17
sp|Q4WTC4|HIR1_ASPFU Protein hir1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hir1 PE=3 SV=1 48 231 1.0E-17
sp|Q74ZN0|HIR1_ASHGO Protein HIR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HIR1 PE=3 SV=2 45 228 2.0E-17
sp|Q1DHE1|HIR1_COCIM Protein HIR1 OS=Coccidioides immitis (strain RS) GN=HIR1 PE=3 SV=1 45 231 4.0E-17
sp|Q5BDU4|HIR1_EMENI Protein hir1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hir1 PE=3 SV=2 45 231 8.0E-17
sp|Q9SXY1|FAS2_ARATH Chromatin assembly factor 1 subunit FAS2 OS=Arabidopsis thaliana GN=FAS2 PE=1 SV=1 640 712 3.0E-15
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 79 231 6.0E-15
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 62 231 6.0E-15
sp|Q9D0N7|CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus GN=Chaf1b PE=1 SV=1 645 712 8.0E-15
sp|O13985|YEG3_SCHPO Uncharacterized WD repeat-containing protein C26H5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.03 PE=1 SV=2 646 711 1.0E-14
sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo sapiens GN=CHAF1B PE=1 SV=1 636 712 2.0E-14
sp|Q0UNC6|HIR1_PHANO Protein HIR1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HIR1 PE=3 SV=1 45 231 4.0E-14
sp|Q04199|CAC2_YEAST Chromatin assembly factor 1 subunit p60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAC2 PE=1 SV=1 640 711 5.0E-14
sp|Q6ZD63|FAS2_ORYSJ Chromatin assembly factor 1 subunit FAS2 homolog OS=Oryza sativa subsp. japonica GN=FAS2 PE=2 SV=1 640 711 7.0E-14
sp|Q5R1S9|CAF1B_CHICK Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 641 723 1.0E-13
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 78 231 3.0E-13
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 21 228 4.0E-13
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 38 228 4.0E-13
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 79 231 8.0E-13
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 79 231 8.0E-13
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 79 231 8.0E-13
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 79 231 9.0E-13
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 21 228 1.0E-12
sp|Q0CQ54|HIR1_ASPTN Protein hir1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hir1 PE=3 SV=1 45 231 1.0E-12
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 78 231 2.0E-12
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 78 231 4.0E-12
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 39 228 5.0E-12
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 89 231 2.0E-11
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 85 231 2.0E-10
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 39 236 4.0E-10
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 39 236 4.0E-10
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 25 260 8.0E-10
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 38 261 9.0E-10
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 39 250 2.0E-09
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 76 252 2.0E-09
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 38 252 2.0E-09
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 46 228 2.0E-09
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 85 231 3.0E-09
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 39 250 3.0E-09
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 45 228 4.0E-09
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 46 227 6.0E-09
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 46 239 8.0E-09
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 75 230 9.0E-09
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 65 231 9.0E-09
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 45 228 1.0E-08
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 34 228 1.0E-08
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 85 231 2.0E-08
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 46 233 2.0E-08
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 80 227 2.0E-08
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 46 233 3.0E-08
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 45 228 3.0E-08
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 45 228 3.0E-08
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 39 230 3.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 89 230 4.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 87 228 4.0E-08
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 45 227 4.0E-08
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 45 228 4.0E-08
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 81 227 5.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 16 227 6.0E-08
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 46 233 6.0E-08
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 46 231 6.0E-08
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 45 228 7.0E-08
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 39 231 8.0E-08
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 83 241 8.0E-08
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 87 239 9.0E-08
sp|A8PWQ8|CIAO1_MALGO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=CIA1 PE=3 SV=1 46 228 9.0E-08
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 26 231 1.0E-07
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 46 239 1.0E-07
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 89 227 1.0E-07
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 45 227 2.0E-07
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 85 227 2.0E-07
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 93 245 2.0E-07
sp|Q9VU68|WDR1_DROME Actin-interacting protein 1 OS=Drosophila melanogaster GN=flr PE=2 SV=1 13 209 2.0E-07
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 46 231 2.0E-07
sp|Q7K1Y4|CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 34 228 2.0E-07
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 71 237 2.0E-07
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 83 298 3.0E-07
sp|B4HRQ6|CIAO1_DROSE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 34 228 3.0E-07
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 34 236 4.0E-07
sp|B3MEY6|LIS1_DROAN Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 71 237 4.0E-07
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 90 231 4.0E-07
sp|Q6LA54|YF48_SCHPO Uncharacterized WD repeat-containing protein C3H5.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.08c PE=1 SV=2 96 236 4.0E-07
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 46 229 4.0E-07
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 71 240 4.0E-07
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 90 231 4.0E-07
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 46 250 4.0E-07
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 39 228 4.0E-07
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 26 231 5.0E-07
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 88 257 5.0E-07
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 87 257 5.0E-07
sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 34 228 5.0E-07
sp|Q09589|HIRA_CAEEL Protein HIRA homolog OS=Caenorhabditis elegans GN=K10D2.1 PE=3 SV=2 11 227 5.0E-07
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 88 254 6.0E-07
sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 34 228 6.0E-07
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 100 312 6.0E-07
sp|Q291L9|LIS1_DROPS Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 71 237 6.0E-07
sp|B4GAJ1|LIS1_DROPE Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 71 237 6.0E-07
sp|B4QFZ8|CIAO1_DROSI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 34 228 6.0E-07
sp|Q2UGU1|LIS1_ASPOR Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 63 231 7.0E-07
sp|B8N9H4|LIS1_ASPFN Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 63 231 7.0E-07
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 71 237 7.0E-07
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 71 237 7.0E-07
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 71 237 7.0E-07
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 83 298 7.0E-07
sp|B4MY77|CIAO1_DROWI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 83 298 8.0E-07
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 73 228 8.0E-07
sp|B4KT48|LIS1_DROMO Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 71 237 8.0E-07
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 71 237 9.0E-07
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 71 237 9.0E-07
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 46 229 9.0E-07
sp|B4LQ21|LIS1_DROVI Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 71 237 9.0E-07
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 46 229 9.0E-07
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 26 233 1.0E-06
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 83 298 1.0E-06
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 87 233 1.0E-06
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 83 229 1.0E-06
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 46 229 1.0E-06
sp|A5DJX5|LIS1_PICGU Nuclear distribution protein PAC1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAC1 PE=3 SV=2 37 186 1.0E-06
sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 34 228 1.0E-06
sp|B4JWA1|LIS1_DROGR Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 71 237 1.0E-06
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 46 229 1.0E-06
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 46 250 1.0E-06
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 45 230 1.0E-06
sp|Q6PAX7|WDR1B_XENLA WD repeat-containing protein 1-B OS=Xenopus laevis GN=wdr1-b PE=2 SV=1 65 185 1.0E-06
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 87 233 1.0E-06
sp|Q6BIR7|HIR2_DEBHA Protein HIR2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HIR2 PE=3 SV=2 45 236 1.0E-06
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 71 237 1.0E-06
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 93 231 2.0E-06
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 38 227 2.0E-06
sp|B4HRQ6|CIAO1_DROSE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 83 298 2.0E-06
sp|Q09589|HIRA_CAEEL Protein HIRA homolog OS=Caenorhabditis elegans GN=K10D2.1 PE=3 SV=2 12 223 2.0E-06
sp|B4MY65|LIS1_DROWI Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 71 237 2.0E-06
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 93 227 2.0E-06
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 34 228 2.0E-06
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 83 298 2.0E-06
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 87 236 2.0E-06
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 71 237 2.0E-06
sp|Q12834|CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2 86 210 2.0E-06
sp|Q5H7C0|CDC20_PIG Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1 85 210 2.0E-06
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 46 231 3.0E-06
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 46 251 3.0E-06
sp|Q9JJ66|CDC20_MOUSE Cell division cycle protein 20 homolog OS=Mus musculus GN=Cdc20 PE=1 SV=2 86 210 3.0E-06
sp|A0AUS0|WSDU1_DANRE WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 39 229 3.0E-06
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 46 229 3.0E-06
sp|Q9W7F2|WDR1A_XENLA WD repeat-containing protein 1-A OS=Xenopus laevis GN=wdr1-a PE=2 SV=2 65 185 3.0E-06
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 87 239 4.0E-06
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 35 229 4.0E-06
sp|Q62623|CDC20_RAT Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2 86 210 4.0E-06
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 87 251 4.0E-06
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 87 237 5.0E-06
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 84 228 5.0E-06
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 102 252 5.0E-06
sp|B3NQR5|CIAO1_DROER Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 34 228 5.0E-06
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 84 228 5.0E-06
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 39 227 6.0E-06
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 88 257 6.0E-06
sp|A8PWQ8|CIAO1_MALGO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=CIA1 PE=3 SV=1 93 227 6.0E-06
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 34 228 6.0E-06
sp|B4QFZ8|CIAO1_DROSI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 83 298 6.0E-06
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 87 238 6.0E-06
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 87 238 6.0E-06
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 82 229 6.0E-06
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 84 228 7.0E-06
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 83 241 7.0E-06
sp|P54198|HIRA_HUMAN Protein HIRA OS=Homo sapiens GN=HIRA PE=1 SV=2 35 217 8.0E-06
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 26 227 8.0E-06
sp|Q7K1Y4|CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 83 298 8.0E-06
sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 83 298 8.0E-06
sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 83 298 8.0E-06
sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 83 241 8.0E-06
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 84 227 8.0E-06
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 46 229 8.0E-06
sp|Q11176|WDR1_CAEEL Actin-interacting protein 1 OS=Caenorhabditis elegans GN=unc-78 PE=1 SV=1 65 185 9.0E-06
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 46 229 1.0E-05
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 82 229 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|115030
MRFRTLEIRWHDSKPISTCDFQPSPFKRARPTVGNEDRFAGHSYRLATGGEDNHVRVWMVYPNIRPTSLVKDDPN
PAAPRPPRIEYLSTLSRHSAAVNVVRFSPNGEFIASAGDDGMVIIWAQSANPVTGAYGSDIPPDEAQMEKEFWKP
RTTFRCTTMQVYDLAWSPTGEYIIAGSTDNTARIFASVDGKCVCEIAEHSHFVQGVAWDPLNEYIATQSSDRSMH
VYRISTKNGAFEAHAVGRNTRMPTRHTRTPSAHGSATTPLLRPKMFRSESCTSDAESAVDKDELPAPLTPATSVG
GTPSLTMFPPPPVLDKGQGSTSSRRSSFSASSNAPGSPHSSFRYGRSPSPMPPLPAIRSLPPSSAWANVKLYGDE
SFTNFFRRLTFSPDGGLLLTPAGQFEDPIIIPSSLSNKGASTSSGTTKDEGGTPTRGRKGKPSVGADASSSAGST
TGNGSTSSSSVYIYSRANFARPPIAQLPGHRKASVAVRFSPILYELRPNVDPGANNDQEPPETKTAALEKGMEGA
LDVDVTGPAVIATPAMESSASSSSATTPHISLLSPQRAPPQGHSQSSSSIAAPAPRLSLSTSQLEGNNATLHSPG
LSPMDVRPPTPAASKPSTPRIHAINSQMMTPQAPSPAVPTSTGSIFALPYRMLYAVVTMDAVAIYDTQQAGPVCL
LTKLHYDEFTDMTWSSDGQTLLLSSRDGYCTIVIFDEIIPASHTQQHVLQLQSIAHQNSVPLVSSNSAASTPATS
TIGLPHLHTHSLTPSSHAKKRSEPPLTPAASADGESSIAGSFNSNFSHNSGSSATTATGSTTAAGSTGSGGSLVA
SSILAPMPSPKLAAVAGKSDISEGHKRQVSGMGGSVDEETNMDSGNTEQPPKKKRRVALTRVGDLDS*
Coding >AgabiH97|115030
ATGCGTTTTCGAACACTCGAGATTAGATGGCACGACTCCAAACCAATTTCGACTTGTGACTTTCAGCCTTCGCCC
TTCAAACGCGCGAGACCGACTGTAGGGAATGAAGACAGGTTTGCCGGTCATTCTTATAGGTTGGCCACCGGTGGG
GAGGATAACCATGTTCGCGTATGGATGGTTTATCCCAACATCAGACCTACCTCGCTTGTCAAGGATGACCCGAAC
CCCGCCGCTCCACGTCCTCCACGGATAGAATACCTATCAACCCTCAGTCGTCATTCCGCTGCAGTCAATGTCGTC
AGATTCTCGCCCAATGGAGAGTTCATTGCCTCCGCTGGTGATGATGGTATGGTCATCATCTGGGCCCAGTCCGCC
AATCCTGTAACTGGTGCTTATGGGAGTGATATTCCTCCTGATGAAGCACAAATGGAGAAGGAGTTTTGGAAACCT
CGGACTACCTTTCGTTGTACCACAATGCAGGTTTATGACCTCGCATGGAGCCCTACTGGTGAATATATCATAGCC
GGGAGCACGGATAACACTGCCCGAATCTTTGCCTCAGTCGATGGGAAGTGCGTCTGTGAGATTGCAGAACATTCT
CATTTCGTGCAAGGAGTCGCATGGGACCCTTTGAATGAGTACATAGCAACACAAAGCAGTGATCGATCCATGCAC
GTCTATCGTATTTCCACGAAGAACGGGGCTTTTGAGGCTCATGCTGTTGGACGTAATACGCGGATGCCGACCCGG
CATACACGCACACCAAGTGCTCATGGTAGTGCCACTACGCCTTTACTCCGTCCCAAAATGTTCCGTAGCGAATCG
TGTACAAGCGATGCCGAATCAGCCGTCGATAAAGACGAGCTCCCTGCACCACTTACCCCAGCAACGTCCGTTGGG
GGTACACCCTCCTTGACCATGTTTCCACCGCCTCCCGTACTTGATAAAGGTCAAGGCTCAACGTCCTCAAGGCGC
TCTTCATTCAGTGCCAGTTCAAATGCACCGGGATCTCCTCATTCTTCTTTCCGATATGGACGTTCACCATCGCCA
ATGCCACCCTTGCCTGCCATCAGAAGCCTGCCACCCTCATCTGCCTGGGCAAATGTCAAACTATATGGAGATGAG
AGCTTTACTAACTTCTTTCGGAGATTGACGTTCAGTCCTGATGGTGGCTTGCTCCTTACTCCAGCTGGGCAATTC
GAGGATCCGATTATCATCCCTTCCAGCTTATCTAATAAGGGTGCATCTACCTCATCGGGTACAACAAAAGATGAG
GGAGGAACACCGACGCGAGGAAGGAAAGGAAAACCTAGTGTTGGCGCAGACGCTTCATCCTCAGCTGGCTCCACC
ACTGGGAATGGATCGACATCATCATCTTCTGTGTATATATATTCCAGGGCCAATTTTGCAAGGCCGCCGATTGCG
CAGTTACCTGGTCATAGGAAAGCCAGTGTCGCTGTTAGGTTTTCTCCCATCTTGTATGAACTCAGGCCGAACGTA
GACCCTGGGGCTAATAACGATCAGGAGCCGCCCGAGACCAAGACGGCTGCGTTGGAAAAGGGCATGGAAGGGGCC
TTGGATGTCGATGTGACTGGACCGGCAGTTATCGCTACTCCAGCAATGGAGTCATCTGCTTCTTCTTCGTCTGCG
ACTACTCCTCATATATCATTATTGAGTCCTCAACGCGCCCCCCCGCAAGGACATTCTCAAAGTTCTTCCTCGATC
GCTGCTCCTGCACCCAGACTTTCGCTTTCTACTTCTCAATTGGAGGGTAATAATGCGACCTTGCATTCTCCTGGA
TTGTCACCGATGGATGTGCGGCCGCCTACACCTGCCGCTTCTAAACCTTCAACACCGCGCATACATGCTATAAAT
TCTCAAATGATGACGCCTCAAGCACCGAGCCCGGCTGTTCCTACAAGTACAGGCTCTATATTTGCTTTGCCTTAT
CGAATGCTTTATGCGGTGGTCACAATGGATGCTGTTGCGATTTATGACACGCAACAAGCCGGCCCCGTATGCCTC
CTGACCAAATTGCATTATGATGAATTTACCGATATGACATGGTCGTCAGATGGTCAAACCCTTTTACTCTCATCG
CGAGATGGTTATTGTACCATTGTGATATTTGATGAGATTATCCCGGCATCACATACGCAACAGCATGTGTTGCAA
CTTCAATCGATCGCGCATCAGAATTCCGTTCCGCTCGTTTCGTCAAATTCTGCTGCGAGTACCCCGGCGACGTCG
ACTATCGGACTACCGCATCTGCATACTCATTCACTTACGCCTTCGTCTCATGCCAAAAAACGTAGTGAACCTCCC
TTGACACCTGCTGCTAGTGCGGATGGGGAAAGTTCTATCGCAGGGTCATTCAACTCAAACTTCAGTCACAATAGT
GGTTCTTCCGCTACTACTGCCACCGGGAGCACGACCGCTGCCGGAAGTACCGGTTCTGGAGGTAGCCTCGTGGCT
TCGTCTATTTTGGCTCCGATGCCAAGTCCAAAATTGGCTGCCGTCGCTGGGAAATCTGATATCAGTGAGGGTCAT
AAAAGGCAAGTTTCCGGCATGGGCGGTAGCGTTGATGAGGAGACGAATATGGATTCTGGGAATACAGAACAGCCG
CCGAAAAAGAAGAGACGTGTCGCTTTGACTCGTGTTGGCGATTTGGACTCATGA
Transcript >AgabiH97|115030
ATGCGTTTTCGAACACTCGAGATTAGATGGCACGACTCCAAACCAATTTCGACTTGTGACTTTCAGCCTTCGCCC
TTCAAACGCGCGAGACCGACTGTAGGGAATGAAGACAGGTTTGCCGGTCATTCTTATAGGTTGGCCACCGGTGGG
GAGGATAACCATGTTCGCGTATGGATGGTTTATCCCAACATCAGACCTACCTCGCTTGTCAAGGATGACCCGAAC
CCCGCCGCTCCACGTCCTCCACGGATAGAATACCTATCAACCCTCAGTCGTCATTCCGCTGCAGTCAATGTCGTC
AGATTCTCGCCCAATGGAGAGTTCATTGCCTCCGCTGGTGATGATGGTATGGTCATCATCTGGGCCCAGTCCGCC
AATCCTGTAACTGGTGCTTATGGGAGTGATATTCCTCCTGATGAAGCACAAATGGAGAAGGAGTTTTGGAAACCT
CGGACTACCTTTCGTTGTACCACAATGCAGGTTTATGACCTCGCATGGAGCCCTACTGGTGAATATATCATAGCC
GGGAGCACGGATAACACTGCCCGAATCTTTGCCTCAGTCGATGGGAAGTGCGTCTGTGAGATTGCAGAACATTCT
CATTTCGTGCAAGGAGTCGCATGGGACCCTTTGAATGAGTACATAGCAACACAAAGCAGTGATCGATCCATGCAC
GTCTATCGTATTTCCACGAAGAACGGGGCTTTTGAGGCTCATGCTGTTGGACGTAATACGCGGATGCCGACCCGG
CATACACGCACACCAAGTGCTCATGGTAGTGCCACTACGCCTTTACTCCGTCCCAAAATGTTCCGTAGCGAATCG
TGTACAAGCGATGCCGAATCAGCCGTCGATAAAGACGAGCTCCCTGCACCACTTACCCCAGCAACGTCCGTTGGG
GGTACACCCTCCTTGACCATGTTTCCACCGCCTCCCGTACTTGATAAAGGTCAAGGCTCAACGTCCTCAAGGCGC
TCTTCATTCAGTGCCAGTTCAAATGCACCGGGATCTCCTCATTCTTCTTTCCGATATGGACGTTCACCATCGCCA
ATGCCACCCTTGCCTGCCATCAGAAGCCTGCCACCCTCATCTGCCTGGGCAAATGTCAAACTATATGGAGATGAG
AGCTTTACTAACTTCTTTCGGAGATTGACGTTCAGTCCTGATGGTGGCTTGCTCCTTACTCCAGCTGGGCAATTC
GAGGATCCGATTATCATCCCTTCCAGCTTATCTAATAAGGGTGCATCTACCTCATCGGGTACAACAAAAGATGAG
GGAGGAACACCGACGCGAGGAAGGAAAGGAAAACCTAGTGTTGGCGCAGACGCTTCATCCTCAGCTGGCTCCACC
ACTGGGAATGGATCGACATCATCATCTTCTGTGTATATATATTCCAGGGCCAATTTTGCAAGGCCGCCGATTGCG
CAGTTACCTGGTCATAGGAAAGCCAGTGTCGCTGTTAGGTTTTCTCCCATCTTGTATGAACTCAGGCCGAACGTA
GACCCTGGGGCTAATAACGATCAGGAGCCGCCCGAGACCAAGACGGCTGCGTTGGAAAAGGGCATGGAAGGGGCC
TTGGATGTCGATGTGACTGGACCGGCAGTTATCGCTACTCCAGCAATGGAGTCATCTGCTTCTTCTTCGTCTGCG
ACTACTCCTCATATATCATTATTGAGTCCTCAACGCGCCCCCCCGCAAGGACATTCTCAAAGTTCTTCCTCGATC
GCTGCTCCTGCACCCAGACTTTCGCTTTCTACTTCTCAATTGGAGGGTAATAATGCGACCTTGCATTCTCCTGGA
TTGTCACCGATGGATGTGCGGCCGCCTACACCTGCCGCTTCTAAACCTTCAACACCGCGCATACATGCTATAAAT
TCTCAAATGATGACGCCTCAAGCACCGAGCCCGGCTGTTCCTACAAGTACAGGCTCTATATTTGCTTTGCCTTAT
CGAATGCTTTATGCGGTGGTCACAATGGATGCTGTTGCGATTTATGACACGCAACAAGCCGGCCCCGTATGCCTC
CTGACCAAATTGCATTATGATGAATTTACCGATATGACATGGTCGTCAGATGGTCAAACCCTTTTACTCTCATCG
CGAGATGGTTATTGTACCATTGTGATATTTGATGAGATTATCCCGGCATCACATACGCAACAGCATGTGTTGCAA
CTTCAATCGATCGCGCATCAGAATTCCGTTCCGCTCGTTTCGTCAAATTCTGCTGCGAGTACCCCGGCGACGTCG
ACTATCGGACTACCGCATCTGCATACTCATTCACTTACGCCTTCGTCTCATGCCAAAAAACGTAGTGAACCTCCC
TTGACACCTGCTGCTAGTGCGGATGGGGAAAGTTCTATCGCAGGGTCATTCAACTCAAACTTCAGTCACAATAGT
GGTTCTTCCGCTACTACTGCCACCGGGAGCACGACCGCTGCCGGAAGTACCGGTTCTGGAGGTAGCCTCGTGGCT
TCGTCTATTTTGGCTCCGATGCCAAGTCCAAAATTGGCTGCCGTCGCTGGGAAATCTGATATCAGTGAGGGTCAT
AAAAGGCAAGTTTCCGGCATGGGCGGTAGCGTTGATGAGGAGACGAATATGGATTCTGGGAATACAGAACAGCCG
CCGAAAAAGAAGAGACGTGTCGCTTTGACTCGTGTTGGCGATTTGGACTCATGA
Gene >AgabiH97|115030
ATGCGTTTTCGAACACTCGAGATTAGATGGCACGACTCCAAACCAATTTCGACTTGTGACTTTCAGCCTTCGCCC
TTCAAACGCGCGAGACCGACTGTAGGGAATGAAGACAGGTTTGCCGGTCATTCTTATAGGTTGGCCACCGGTGGG
GAGGATAACCATGTTCGCGTATGTATCACCTTTCACCCTTTTCGCTGTCTATTGCAAATTCATTGAACGGCTGCA
GGTATGGATGGTTTATCCCAACATCAGACCTACCTCGCTTGTCAAGGATGACCCGAACCCCGCCGCTCCACGTCC
TCCACGGATAGAATACCTATCAACCCTCAGTCGTCATTCCGCTGCAGTCAATGTCGTCAGATTCTCGCCCAATGG
TAACGTCTTTCATGCCTGCGTTGTGGATGCGGTGCATTGATGCAGATCTAACTAAATAGGAGAGTTCATTGCCTC
CGCTGGTGATGGTACGTGCCACCGCCCACAATGCACCTTCTCAGGACGCGTTTTTCTCAATCTTTTTGTATAGAT
GGTATGGTCATCATCTGGGCCCAGTCCGCCAATCCTGTAACTGGTGCTTATGGGAGTGATATTCCTCCTGATGAA
GCACAAATGGAGAAGGAGTTTTGGAAACCTCGGACTACCTTTCGGTACATCGTCTCACTGTCTCTTATTCCACAA
CAGTGCTCAAAACATTCTAGTTGTACCACAATGCAGGTTTATGACCTCGCATGGAGCCCTACTGGTGAATATATC
ATAGCCGGGAGCACGGATAACACTGCCCGAATCTTTGCCTCAGTCGATGGTATGTACATGCGACACTCTTATTAC
ATATAAAGGCGGTCTAATTTGACTATCATCAAACAGGGAAGTGCGTCTGTGAGATTGCAGAACATTCTCATTTCG
TGCAAGGAGTCGCATGGGACCCTTTGAATGAGTACATAGCAACACAAAGCAGTGATCGATCCATGCACGTCTATC
GTATTTCCACGAAGAACGGGGCTTTTGAGGCTCATGCTGTTGGACGTAATACGCGGATGCCGACCCGGCATACAC
GCACACCAAGTGCTCATGGTAGTGCCACTACGCCTTTACTCCGTCCCAAAATGTTCCGTAGCGAATCGTGTACAA
GCGATGCCGAATCAGCCGTCGATAAAGACGAGCTCCCTGCACCACTTACCCCAGCAACGTCCGTTGGGGGTACAC
CCTCCTTGACCATGTTTCCACCGCCTCCCGTACTTGATAAAGGTCAAGGCTCAACGTCCTCAAGGCGCTCTTCAT
TCAGTGCCAGTTCAAATGCACCGGGATCTCCTCATTCTTCTTTCCGATATGGACGTTCACCATCGCCAATGCCAC
CCTTGCCTGCCATCAGAAGCCTGCCACCCTCATCTGCCTGGGCAAATGTCAAACTATATGGAGATGAGAGCTTTA
CTAACTTCTTTCGGAGATTGACGTTCAGTCCTGATGGTGGCTTGCTCCTTACTCCAGCTGGGCAATTCGAGGATC
CGATTATCATCCCTTCCAGCTTATCTAATAAGGGTGCATCTACCTCATCGGGTACAACAAAAGATGAGGGAGGAA
CACCGACGCGAGGAAGGAAAGGAAAACCTAGTGTTGGCGCAGACGCTTCATCCTCAGCTGGCTCCACCACTGGGA
ATGGATCGACATCATCATCTTCTGTGTATATATATTCCAGGGCCAATTTTGCAAGGCCGCCGATTGCGCAGTTAC
CTGGTCATAGGAAAGCCAGTGTCGCTGTTAGGTTTTCTCCCATCTTGTATGAACTCAGGCCGAACGTAGACCCTG
GGGCTAATAACGATCAGGAGCCGCCCGAGACCAAGACGGCTGCGTTGGAAAAGGGCATGGAAGGGGCCTTGGATG
TCGATGTGACTGGACCGGCAGTTATCGCTACTCCAGCAATGGAGTCATCTGCTTCTTCTTCGTCTGCGACTACTC
CTCATATATCATTATTGAGTCCTCAACGCGCCCCCCCGCAAGGACATTCTCAAAGTTCTTCCTCGATCGCTGCTC
CTGCACCCAGACTTTCGCTTTCTACTTCTCAATTGGAGGGTAATAATGCGACCTTGCATTCTCCTGGATTGTCAC
CGATGGATGTGCGGCCGCCTACACCTGCCGCTTCTAAACCTTCAACACCGCGCATACATGCTATAAATTCTCAAA
TGATGACGCCTCAAGCACCGAGCCCGGCTGTTCCTACAAGTACAGGCTCTATATTTGCTTTGCCTTATCGAATGC
TTTATGCGGTGGTCACAATGGATGCTGTTGCGATTTATGACACGCAACAAGCCGGCCCCGTATGCCTCCTGACCA
AATTGCATTATGATGAATTTACCGATATGACATGGTATGTCAGCCCTTGGTTCAAAATTTCCCAACTTATTCTGA
TGATACCCTATCTTTCTTTACCCGTGCGCCTTGATAGGTCGTCAGATGGTCAAACCCTTTTACTCTCATCGCGAG
ATGGTTATTGTACCATTGTGATATTTGATGAGATTATCCCGGCATCACATACGCAACAGCATGTGTTGCAACTTC
AATCGATCGCGCATCAGAATTCCGTTCCGCTCGTTTCGTCAAATTCTGCTGCGAGTACCCCGGCGACGTCGACTA
TCGGACTACCGCATCTGCATACTCATTCACTTACGCCTTCGTCTCATGCCAAAAAACGTAGTGAACCTCCCTTGA
CACCTGCTGCTAGTGCGGATGGGGAAAGTTCTATCGCAGGGTCATTCAACTCAAACTTCAGTCACAATAGTGGTT
CTTCCGCTACTACTGCCACCGGGAGCACGACCGCTGCCGGAAGTACCGGTTCTGGAGGTAGCCTCGTGGCTTCGT
CTATTTTGGCTCCGATGCCAAGTCCAAAATTGGCTGCCGTCGCTGGGAAATCTGATATCAGTGAGGGTCATAAAA
GGCAAGTTTCCGGCATGGGCGGTAGCGTTGATGAGGAGACGAATATGGATTCTGGGAATACAGAACAGCCGCCGA
AAAAGAAGAGACGTGTCGCTTTGACTCGTGTTGGCGATTTGGACTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail