Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|114880
Gene name
Locationscaffold_9:345626..348772
Strand+
Gene length (bp)3146
Transcript length (bp)2187
Coding sequence length (bp)2187
Protein length (aa) 729

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31 8.5E-89 242 716

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QTU5|XYLA_ASPNC Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=axlA PE=1 SV=1 18 728 0.0E+00
sp|Q01336|YCR2_ESCVU Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Escherichia vulneris PE=3 SV=1 37 571 3.0E-71
sp|Q9P999|XYLS_SULSO Alpha-xylosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=xylS PE=1 SV=1 146 715 4.0E-60
sp|A7LXT0|GH31A_BACO1 Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02646 PE=1 SV=1 231 715 5.0E-54
sp|Q9F234|AGL2_BACTQ Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens PE=3 SV=1 109 715 4.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QTU5|XYLA_ASPNC Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=axlA PE=1 SV=1 18 728 0.0E+00
sp|Q01336|YCR2_ESCVU Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Escherichia vulneris PE=3 SV=1 37 571 3.0E-71
sp|Q9P999|XYLS_SULSO Alpha-xylosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=xylS PE=1 SV=1 146 715 4.0E-60
sp|A7LXT0|GH31A_BACO1 Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02646 PE=1 SV=1 231 715 5.0E-54
sp|Q9F234|AGL2_BACTQ Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens PE=3 SV=1 109 715 4.0E-39
sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis GN=GANC PE=2 SV=2 227 718 9.0E-38
sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens GN=GANC PE=2 SV=3 227 718 1.0E-37
sp|B3PEE6|OL4AG_CELJU Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=agd31B PE=1 SV=1 151 715 3.0E-36
sp|Q8BVW0|GANC_MOUSE Neutral alpha-glucosidase C OS=Mus musculus GN=Ganc PE=1 SV=2 227 718 5.0E-36
sp|Q5AW25|AGDD_EMENI Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdD PE=1 SV=1 177 715 8.0E-35
sp|B9F676|GLU2A_ORYSJ Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica GN=Os03g0216600 PE=3 SV=1 210 715 7.0E-33
sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus musculus GN=Ganab PE=1 SV=1 211 718 2.0E-29
sp|Q9FN05|PSL5_ARATH Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana GN=PSL5 PE=1 SV=1 223 715 7.0E-29
sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens GN=GANAB PE=1 SV=3 211 718 2.0E-28
sp|P31434|XYLS_ECOLI Alpha-xylosidase OS=Escherichia coli (strain K12) GN=yicI PE=1 SV=2 93 696 4.0E-28
sp|P79403|GANAB_PIG Neutral alpha-glucosidase AB OS=Sus scrofa GN=GANAB PE=1 SV=1 211 718 6.0E-28
sp|Q4R4N7|GANAB_MACFA Neutral alpha-glucosidase AB OS=Macaca fascicularis GN=GANAB PE=2 SV=1 211 718 8.0E-28
sp|Q94502|GANAB_DICDI Neutral alpha-glucosidase AB OS=Dictyostelium discoideum GN=modA PE=3 SV=1 220 718 2.0E-25
sp|P0CD66|AGLU_SULSO Alpha-glucosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=malA PE=1 SV=1 154 709 2.0E-24
sp|D0KQM8|AGLU_SULS9 Alpha-glucosidase OS=Sulfolobus solfataricus (strain 98/2) GN=malA PE=1 SV=1 154 709 3.0E-24
sp|Q653V7|AGLU_ORYSJ Probable alpha-glucosidase Os06g0675700 OS=Oryza sativa subsp. japonica GN=Os06g0675700 PE=1 SV=1 230 718 1.0E-22
sp|P32138|YIHQ_ECOLI Alpha-glucosidase YihQ OS=Escherichia coli (strain K12) GN=yihQ PE=1 SV=3 243 721 5.0E-22
sp|Q9US55|GLU2A_SCHPO Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gls2 PE=3 SV=1 227 718 2.0E-21
sp|Q12558|AGLU_ASPOR Alpha-glucosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdA PE=2 SV=1 482 718 4.0E-21
sp|P70699|LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus GN=Gaa PE=1 SV=2 230 681 1.0E-20
sp|P56526|AGLU_ASPNG Alpha-glucosidase OS=Aspergillus niger GN=aglA PE=1 SV=1 482 718 1.0E-20
sp|P10253|LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens GN=GAA PE=1 SV=4 230 680 8.0E-20
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 450 718 2.0E-19
sp|Q6P7A9|LYAG_RAT Lysosomal alpha-glucosidase OS=Rattus norvegicus GN=Gaa PE=2 SV=1 230 681 3.0E-19
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 248 680 5.0E-19
sp|Q43763|AGLU_HORVU Alpha-glucosidase OS=Hordeum vulgare PE=2 SV=1 230 718 8.0E-19
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 248 718 1.0E-18
sp|Q5R7A9|LYAG_PONAB Lysosomal alpha-glucosidase OS=Pongo abelii GN=GAA PE=2 SV=1 230 680 2.0E-18
sp|Q09901|YAJ1_SCHPO Uncharacterized family 31 glucosidase C30D11.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.01c PE=3 SV=2 455 714 2.0E-18
sp|O04931|AGLU_BETVU Alpha-glucosidase OS=Beta vulgaris PE=1 SV=1 183 714 3.0E-18
sp|O04893|AGLU_SPIOL Alpha-glucosidase OS=Spinacia oleracea PE=1 SV=1 248 714 3.0E-18
sp|Q92442|AGLU_MUCJA Alpha-glucosidase OS=Mucor javanicus PE=1 SV=1 230 718 2.0E-17
sp|Q9URX4|YFZB_SCHPO Uncharacterized family 31 glucosidase C1039.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.11c PE=3 SV=1 433 714 5.0E-17
sp|Q9MYM4|LYAG_BOVIN Lysosomal alpha-glucosidase OS=Bos taurus GN=GAA PE=2 SV=1 230 714 1.0E-16
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 230 718 1.0E-16
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 248 697 1.0E-16
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 450 718 2.0E-16
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 457 680 3.0E-16
sp|P38138|GLU2A_YEAST Glucosidase 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROT2 PE=1 SV=1 227 718 7.0E-16
sp|Q9C0Y4|AGLU_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agl1 PE=1 SV=2 482 714 7.0E-15
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 244 697 8.0E-15
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 450 718 9.0E-15
sp|F4J6T7|XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana GN=XYL2 PE=5 SV=1 249 714 1.0E-14
sp|O74254|AMYG_CANAL Glucoamylase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAM1 PE=1 SV=2 482 718 5.0E-14
sp|Q9S7Y7|XYL1_ARATH Alpha-xylosidase 1 OS=Arabidopsis thaliana GN=XYL1 PE=1 SV=1 482 714 2.0E-12
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 248 700 8.0E-12
sp|Q2UQV7|AGDC_ASPOR Probable alpha/beta-glucosidase agdC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdC PE=3 SV=1 465 718 8.0E-12
sp|B8MZ41|AGDC_ASPFN Probable alpha/beta-glucosidase agdC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=agdC PE=3 SV=1 465 718 8.0E-12
sp|Q69ZQ1|K1161_MOUSE Uncharacterized family 31 glucosidase KIAA1161 OS=Mus musculus GN=Kiaa1161 PE=1 SV=2 273 688 9.0E-12
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 450 700 1.0E-11
sp|Q6NSJ0|K1161_HUMAN Uncharacterized family 31 glucosidase KIAA1161 OS=Homo sapiens GN=KIAA1161 PE=1 SV=2 273 688 1.0E-10
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 450 718 5.0E-10
sp|A1CNK4|AGDC_ASPCL Probable alpha/beta-glucosidase agdC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=agdC PE=3 SV=1 465 718 5.0E-10
sp|O00906|AGLU_TETPY Lysosomal acid alpha-glucosidase OS=Tetrahymena pyriformis PE=1 SV=1 482 667 8.0E-10
sp|P29064|AGLU_CANTS Alpha-glucosidase OS=Candida tsukubaensis PE=1 SV=1 482 714 8.0E-10
sp|Q5AWI5|AGDC_EMENI Alpha/beta-glucosidase agdC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdC PE=2 SV=2 480 720 2.0E-09
sp|Q0CMA7|AGDC_ASPTN Probable alpha/beta-glucosidase agdC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=agdC PE=3 SV=1 482 718 2.0E-08
sp|P22861|AMYG_SCHOC Glucoamylase 1 OS=Schwanniomyces occidentalis GN=GAM1 PE=1 SV=1 482 718 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|114880
MVLQSLILCYLVLPISLSLAADYFNPNATGIKLQNGFERIHIQPFGNHGFRVRASLLRDPTGREPSALLDPPLEG
PSSKGLEHSITIPFRGNATVRNGNLVVDVSFGVTSFSRVEPNGTLTLLTSEYVDTKVLPARYYVQDIHGQSFQAQ
FGFSADPDEMFFGTGQHACCKDHTVNKKGQIVDLINYNSHVTLPIWMSNKGYLMFFNYPGQGRIEFDRLRTRFVA
DEATVVDYWITTAPPEDYDALQQQFTGVTGRQPTPPEFSLGFQQSKLRYYNQTQITDLAQRFHDEQVQVSLIVID
FFAWKFQGDWSLDVDVWPDPTAMAAEVKRLTGAELMVSLWPSVEDLSENYLTLQEEGLLAITRDGTGIQDSFEGV
YTRLIDSTNPDAREFLWKRLNDSYFSKGIHNFWIDQADGGTLGEPFENNGQSISSIPYSRSFTQYFLGSQEGFGK
MYPWLHQQAIQEGFQNLTGTDSSQESCEYMSLTRSTFIGGQRFCSYLWSGDTDSKFDVLLQQITAGVSVAASGIS
SWTLDIGGFAGLDIDTDEGKELFVRWFSMGVFLPYTRVHGTRSCNIPRTSTLPHANPCPNEPWSYGEDNFVILKK
YIALRYQLIPYVKTLFQMLHTSGKVILRPLYFDFSKSDEFVRKGTKTNDPVVVHQFMFGPRLLVAPVGEFGVKTW
DVYLPKLDTQTWKHWWTDHDFGKGGMSITIDAPLDQIPVFYLGDKDDILNGNI*
Coding >AgabiH97|114880
ATGGTACTGCAAAGCCTGATTTTGTGCTACCTGGTGTTACCGATTTCGCTCTCACTCGCTGCTGATTATTTCAAT
CCAAACGCAACTGGTATCAAACTCCAAAACGGATTTGAACGCATTCATATCCAGCCCTTTGGAAACCATGGATTC
CGCGTTCGTGCTAGCCTTCTTCGCGACCCCACGGGTCGTGAGCCCTCTGCTCTCCTTGATCCTCCTTTGGAGGGT
CCAAGTTCAAAAGGCCTTGAACATTCCATCACTATACCCTTCCGTGGTAACGCAACTGTCCGTAACGGAAATCTA
GTTGTCGATGTATCTTTCGGCGTCACTTCGTTCTCCCGTGTAGAGCCCAATGGAACGTTGACGCTTCTCACCAGC
GAATATGTCGACACAAAGGTTTTACCTGCGCGGTACTACGTTCAAGACATTCATGGACAATCTTTCCAAGCACAA
TTTGGTTTCTCAGCTGATCCTGACGAGATGTTCTTTGGTACTGGACAGCATGCTTGTTGCAAAGATCACACCGTG
AATAAAAAGGGTCAGATAGTTGATCTCATCAACTATAACTCACATGTAACTTTGCCTATATGGATGTCGAACAAG
GGCTACTTGATGTTTTTCAATTATCCAGGCCAAGGTCGCATTGAATTTGATCGTCTCAGGACTCGCTTTGTCGCA
GATGAGGCAACGGTGGTGGATTATTGGATCACGACAGCACCTCCCGAAGACTACGATGCCCTTCAGCAGCAGTTC
ACAGGCGTAACAGGTCGTCAACCAACTCCACCCGAATTCTCTCTTGGTTTTCAACAATCGAAACTTAGATACTAC
AATCAGACACAGATCACTGATCTAGCTCAGAGGTTCCACGATGAACAGGTTCAAGTTTCTTTAATCGTCATCGAT
TTCTTTGCGTGGAAGTTTCAAGGAGATTGGTCTTTGGACGTCGATGTCTGGCCAGACCCTACAGCAATGGCAGCA
GAAGTCAAAAGACTGACTGGAGCAGAACTCATGGTTTCTTTATGGCCAAGTGTAGAAGATTTATCCGAGAACTAT
CTTACTCTCCAGGAAGAAGGACTCCTAGCGATTACTAGAGACGGAACCGGTATTCAAGATTCTTTTGAAGGAGTC
TATACTAGACTAATTGACTCGACAAATCCTGACGCGAGAGAGTTTCTTTGGAAAAGGTTAAACGACAGCTATTTC
TCAAAAGGCATTCACAATTTTTGGATTGATCAAGCTGATGGAGGAACGCTCGGTGAACCATTCGAGAACAATGGT
CAATCAATCAGCTCCATTCCGTATTCCCGTTCCTTTACGCAATATTTTCTTGGTTCTCAAGAGGGATTCGGGAAA
ATGTATCCTTGGCTTCATCAACAAGCTATTCAAGAAGGTTTCCAAAATCTCACCGGCACAGATTCCTCTCAAGAG
TCATGTGAATATATGTCTTTGACGAGAAGTACTTTTATTGGAGGACAACGATTTTGTTCTTATTTGTGGAGTGGG
GATACGGATTCAAAGTTTGATGTGTTGTTGCAACAGATTACGGCTGGAGTTTCTGTTGCTGCTTCGGGTATCTCT
TCTTGGACACTTGATATTGGTGGGTTTGCGGGGCTGGATATTGATACTGATGAGGGAAAGGAATTGTTCGTTAGA
TGGTTTTCGATGGGTGTATTTCTCCCTTATACTCGCGTTCATGGCACACGATCATGCAATATACCAAGAACATCT
ACTCTACCACATGCTAATCCTTGTCCAAACGAACCATGGTCTTACGGCGAAGACAATTTCGTCATTCTCAAAAAG
TACATTGCTCTCCGTTATCAACTCATCCCTTACGTCAAAACCCTCTTCCAAATGTTACACACATCAGGAAAAGTC
ATCCTGCGACCGCTTTATTTCGATTTCTCAAAATCAGACGAGTTCGTGAGGAAGGGTACAAAAACAAATGACCCT
GTTGTCGTTCATCAATTCATGTTCGGACCTCGGCTTCTTGTTGCGCCTGTAGGCGAATTCGGTGTCAAGACATGG
GATGTCTATTTACCCAAACTAGATACTCAAACATGGAAACATTGGTGGACGGATCACGATTTTGGAAAAGGTGGA
ATGTCAATTACAATTGATGCACCGTTGGATCAGATCCCCGTTTTTTATCTAGGAGACAAAGACGATATCCTCAAC
GGAAACATTTAG
Transcript >AgabiH97|114880
ATGGTACTGCAAAGCCTGATTTTGTGCTACCTGGTGTTACCGATTTCGCTCTCACTCGCTGCTGATTATTTCAAT
CCAAACGCAACTGGTATCAAACTCCAAAACGGATTTGAACGCATTCATATCCAGCCCTTTGGAAACCATGGATTC
CGCGTTCGTGCTAGCCTTCTTCGCGACCCCACGGGTCGTGAGCCCTCTGCTCTCCTTGATCCTCCTTTGGAGGGT
CCAAGTTCAAAAGGCCTTGAACATTCCATCACTATACCCTTCCGTGGTAACGCAACTGTCCGTAACGGAAATCTA
GTTGTCGATGTATCTTTCGGCGTCACTTCGTTCTCCCGTGTAGAGCCCAATGGAACGTTGACGCTTCTCACCAGC
GAATATGTCGACACAAAGGTTTTACCTGCGCGGTACTACGTTCAAGACATTCATGGACAATCTTTCCAAGCACAA
TTTGGTTTCTCAGCTGATCCTGACGAGATGTTCTTTGGTACTGGACAGCATGCTTGTTGCAAAGATCACACCGTG
AATAAAAAGGGTCAGATAGTTGATCTCATCAACTATAACTCACATGTAACTTTGCCTATATGGATGTCGAACAAG
GGCTACTTGATGTTTTTCAATTATCCAGGCCAAGGTCGCATTGAATTTGATCGTCTCAGGACTCGCTTTGTCGCA
GATGAGGCAACGGTGGTGGATTATTGGATCACGACAGCACCTCCCGAAGACTACGATGCCCTTCAGCAGCAGTTC
ACAGGCGTAACAGGTCGTCAACCAACTCCACCCGAATTCTCTCTTGGTTTTCAACAATCGAAACTTAGATACTAC
AATCAGACACAGATCACTGATCTAGCTCAGAGGTTCCACGATGAACAGGTTCAAGTTTCTTTAATCGTCATCGAT
TTCTTTGCGTGGAAGTTTCAAGGAGATTGGTCTTTGGACGTCGATGTCTGGCCAGACCCTACAGCAATGGCAGCA
GAAGTCAAAAGACTGACTGGAGCAGAACTCATGGTTTCTTTATGGCCAAGTGTAGAAGATTTATCCGAGAACTAT
CTTACTCTCCAGGAAGAAGGACTCCTAGCGATTACTAGAGACGGAACCGGTATTCAAGATTCTTTTGAAGGAGTC
TATACTAGACTAATTGACTCGACAAATCCTGACGCGAGAGAGTTTCTTTGGAAAAGGTTAAACGACAGCTATTTC
TCAAAAGGCATTCACAATTTTTGGATTGATCAAGCTGATGGAGGAACGCTCGGTGAACCATTCGAGAACAATGGT
CAATCAATCAGCTCCATTCCGTATTCCCGTTCCTTTACGCAATATTTTCTTGGTTCTCAAGAGGGATTCGGGAAA
ATGTATCCTTGGCTTCATCAACAAGCTATTCAAGAAGGTTTCCAAAATCTCACCGGCACAGATTCCTCTCAAGAG
TCATGTGAATATATGTCTTTGACGAGAAGTACTTTTATTGGAGGACAACGATTTTGTTCTTATTTGTGGAGTGGG
GATACGGATTCAAAGTTTGATGTGTTGTTGCAACAGATTACGGCTGGAGTTTCTGTTGCTGCTTCGGGTATCTCT
TCTTGGACACTTGATATTGGTGGGTTTGCGGGGCTGGATATTGATACTGATGAGGGAAAGGAATTGTTCGTTAGA
TGGTTTTCGATGGGTGTATTTCTCCCTTATACTCGCGTTCATGGCACACGATCATGCAATATACCAAGAACATCT
ACTCTACCACATGCTAATCCTTGTCCAAACGAACCATGGTCTTACGGCGAAGACAATTTCGTCATTCTCAAAAAG
TACATTGCTCTCCGTTATCAACTCATCCCTTACGTCAAAACCCTCTTCCAAATGTTACACACATCAGGAAAAGTC
ATCCTGCGACCGCTTTATTTCGATTTCTCAAAATCAGACGAGTTCGTGAGGAAGGGTACAAAAACAAATGACCCT
GTTGTCGTTCATCAATTCATGTTCGGACCTCGGCTTCTTGTTGCGCCTGTAGGCGAATTCGGTGTCAAGACATGG
GATGTCTATTTACCCAAACTAGATACTCAAACATGGAAACATTGGTGGACGGATCACGATTTTGGAAAAGGTGGA
ATGTCAATTACAATTGATGCACCGTTGGATCAGATCCCCGTTTTTTATCTAGGAGACAAAGACGATATCCTCAAC
GGAAACATTTAG
Gene >AgabiH97|114880
ATGGTACTGCAAAGCCTGATTTTGTGCTACCTGGTGTTACCGATTTCGCTCTCACTCGCTGCTGATTATTTCAAT
CCAAACGCAACTGGTATCAAACTCCAAAACGGATTTGAACGCATTCATATCCAGGTAAGACGCCTAAAATCTCTG
TTCAGTATTATTTACAGGAATTTCTAGCCCTTTGGAAACCATGGATTCCGCGTTCGTGCTAGCCTTCTTCGCGAC
CCCACGGGTCGTGAGCCCTCTGCTCTCCTTGATCCTCCTTTGGAGGGTCCAAGTTCAAAAGGCCTTGAACATTCC
ATCACTATACCCTTCCGTGGTAACGCAACTGTCCGTAACGGAAATCTAGTTGTCGATGTATCTTTCGGCGTCACT
TCGTTCTCCCGTGTAGAGCCCAATGGAACGTTGACGCTTCTCACCAGCGAATATGTCGACACAAAGGTTTTACCT
GCGCGGTACTACGTTCAAGACATTCATGGACAATCTTTCCAAGCACAATTTGGTTTCTCAGCTGATCCTGACGAG
ATGTTCTTTGGTACTGGACAGCATGCTTGTTGCAAAGATCACACCGTGAATAAAAAGGGTCAGATAGTTGATCTC
ATCAACTATAACTCACATGTAACTTTGCCTATATGGATGTCGAACAAGGTGAGCCTGATATAGATCGTGCACCAT
TTCTTTATGAACAACAGACCAAAATGCAAGGGCTACTTGATGTTTTTCAATTATCCAGGCCAAGGTCGCATTGGT
GAGATATGTCCTCAGTTGCGACGTCTCCCAAATGAAAATTGCTTCCCCAGAATTTGATCGTCTCAGGACTCGCTT
TGTCGCAGATGAGGCAACGGTGGTGGATTATTGGATGTGAGTTTATATATCACTTGACTCGATATTGATCATTCA
TAGCTTTGGCAGCACGACAGCACCTCCCGAAGACTACGATGCCCTTCAGCAGCAGTTCACAGGCGTAACAGGTAT
GTATTTTTTGGCAAGTCAGCAAATCGCGTAATAATGTGATGCAGGTCGTCAACCAACTCCACCCGAATTCTCTCT
TGGTTTTCAACAATCGAAACTTAGATACTACAATCAGACACAGATCACTGATCTAGCTCAGAGGTTCCACGATGA
ACAGGTTCAAGTTTCTTTAATCGTCATCGGTACGTCTTTGTCTTTCCATACATAGCAATGCAAGCTTTATTCACA
CGTAAATATAGATTTCTTTGCGTGGAAGTTTCAAGGAGATTGGTTCGTCATTATTCATTCTCTTTTCAAGTTTAA
TGTAAAACAAAAAAAAGGTCTTTGGACGTCGATGTCTGGCCAGACCCTACAGCAATGGCAGCAGAAGTCAAAAGA
CTGACTGGAGCAGAACTCATGGTTTCTTTATGGCCAAGTGTAGAAGATTTATCCGAGAACTATCTTACTCTCCAG
GAAGAAGGACTCCTAGCGATTACTAGAGACGGAACCGGTATTCAAGATTCTTTTGAAGGAGTCTATACTAGACTA
AGTCCGTTCACATCAAACATTTTGTTGGGGGGGTGGCTCAATTTGCTGAATTCCTAACTCAGTTGACTCGACAAA
TCCTGACGCGAGAGAGTTTCTTTGTACGTTTTTACTTCCCATCACTATCTCCACGTGTCAGTACTCCTGATCACC
AGACAACAGGGAAAAGGTTAAACGACAGCTATTTCTCAAAAGGCATTCACAATTTTTGGATTGATCAAGCTGATG
GTATGTTTCTAAATATTGCAAACTCCGTGTTTCATCAATATCTTGCCCCCGCAGGAGGAACGCTCGGTGAACCAT
TCGAGAACAATGGTCAATCAATCAGCTCCATTCCGTATTCCCGTTCCTTTACGCAATATTTTCTTGGTTCTCAAG
AGGGATTCGGGAAAATGTATCCTTGGCTTCATCAACAAGCTATTCAAGAAGGTTTCCAAAATCTCACCGGCACAG
ATTCCTCTCAAGAGTCATGTGAATATATGTCTTTGACGAGAAGTACTTTTATTGGAGGACAACGATTTTGTTCTT
ATTTGTGGAGTGGGGATACGGATTCAAAGTTTGATGTGTTGTTGCAACAGATTACGGCTGGAGTTTCTGTTGCTG
CTTCGGGTATCTCTTCTTGGACACTTGATATTGGTGGGTTTGCGGGGCTGGATATTGATACTGATGAGGTGAGAT
ATGATGTTTACATTACTGAGAAACTGTGCTAAACTTGTGATGGATAGGGAAAGGAATTGTTCGTTAGATGGTTTT
CGATGGGTGTATTTCTCCCTTATGTGAGTTTAATACTTTGCTTATGAATATTGATTGATGATCCTCGACAGACTC
GCGTTCATGGGTAAGTTTTTCATCAATCGAATGTTAAAACTCAATCTCATGCTTTTGACTTTCAGCACACGATCA
TGCAATATACCAAGAACATCTACTCTACCACATGCTAATCCTTGTCCAAACGAAGTACGCAATTCCTTTCACTTC
CATGCCATAAAATTTTAAATAAAAATCGTTACTAGCCATGGTCTTACGGCGAAGACAATTTCGTCATTCTCAAAA
AGGTATATACTATTATCCTTTCTTTTTTTTCAATACTCCTAAGTTTCTTCCTAAAATCACGTTCAAAAGTACATT
GCTCTCCGTTATCAACTCATCCCTTACGTCAAAACCCTCTTCCAAATGTTACACACATCAGGAAAAGTCATCCTG
CGACCGCTTTATTTCGATTTCTCAAAATCAGACGAGTTCGTGAGGAAGGGTACAAAAACAAATGACCCTGTTGTC
GTTCATCAATTCATGTTCGGTTCGTTCACTTTCTACTAAAAAGAAAAAACAAACAAGCAAACAAATTTCATGTGT
GCGTTTTTTTTTTTTCTAGGACCTCGGCTTCTTGTTGCGCCTGTAGGCGAATTCGGTGTCAAGACATGGGATGTC
TATTTACCCAAACTAGATACTCAAACATGGAAACATTGGCAAGTTACAAGTTTACACTCTCCCTTTTTGATAAAA
AAAAAATCTGAGCAATCCAAATTCCTAGGTGGACGGATCACGATTTTGGAAAAGGTGGAATGTCAATTACAATTG
ATGCACCGTTGGATCAGATCCCCGTTTTTTATCTAGGAGACAAAGACGATATCCTCAACGGAAACATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail