Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|114820
Gene name
Locationscaffold_9:325702..327409
Strand-
Gene length (bp)1707
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 4.6E-24 53 165
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.2E-15 207 333

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O34788|BDHA_BACSU (R,R)-butanediol dehydrogenase OS=Bacillus subtilis (strain 168) GN=bdhA PE=3 SV=1 1 376 2.0E-56
sp|P39713|BDH2_YEAST Probable diacetyl reductase [(R)-acetoin forming] 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDH2 PE=1 SV=1 1 379 3.0E-56
sp|P39714|BDH1_YEAST (R,R)-butanediol dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDH1 PE=1 SV=2 1 379 5.0E-56
sp|Q0CWQ2|XYL2_ASPTN Probable D-xylulose reductase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xdhA PE=3 SV=1 54 364 4.0E-42
sp|Q86ZV0|XYL2_ASPOR D-xylulose reductase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xdhA PE=3 SV=2 39 367 8.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O34788|BDHA_BACSU (R,R)-butanediol dehydrogenase OS=Bacillus subtilis (strain 168) GN=bdhA PE=3 SV=1 1 376 2.0E-56
sp|P39713|BDH2_YEAST Probable diacetyl reductase [(R)-acetoin forming] 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDH2 PE=1 SV=1 1 379 3.0E-56
sp|P39714|BDH1_YEAST (R,R)-butanediol dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDH1 PE=1 SV=2 1 379 5.0E-56
sp|Q0CWQ2|XYL2_ASPTN Probable D-xylulose reductase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xdhA PE=3 SV=1 54 364 4.0E-42
sp|Q86ZV0|XYL2_ASPOR D-xylulose reductase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xdhA PE=3 SV=2 39 367 8.0E-42
sp|Q5GN51|XYL2_ASPNG D-xylulose reductase A OS=Aspergillus niger GN=xdhA PE=3 SV=1 35 367 3.0E-41
sp|A2QY54|XYL2_ASPNC Probable D-xylulose reductase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xdhA PE=3 SV=1 35 367 3.0E-41
sp|Q06004|DHSO_BACSU Sorbitol dehydrogenase OS=Bacillus subtilis (strain 168) GN=gutB PE=1 SV=3 1 376 3.0E-41
sp|Q5ARL6|XYL2_EMENI Probable D-xylulose reductase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xdhA PE=3 SV=1 41 366 3.0E-40
sp|A1D9C9|XYL2_NEOFI Probable D-xylulose reductase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xdhA PE=3 SV=1 39 366 4.0E-38
sp|Q4WAU7|XYL2_ASPFU Probable D-xylulose reductase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xdhA PE=3 SV=2 39 366 6.0E-38
sp|B0YC65|XYL2_ASPFC Probable D-xylulose reductase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xdhA PE=3 SV=2 39 366 6.0E-38
sp|C5FTT1|XYL2_ARTOC Probable D-xylulose reductase A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=xdhA PE=3 SV=1 29 367 7.0E-38
sp|A1CFY8|XYL2_ASPCL Probable D-xylulose reductase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xdhA PE=3 SV=2 54 366 1.0E-37
sp|Q8KQL2|ARPD_ENTAV D-arabitol-phosphate dehydrogenase OS=Enterococcus avium PE=1 SV=1 1 351 2.0E-35
sp|Q9Z9U1|DHSO_BACHD Sorbitol dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gutB PE=3 SV=1 7 318 5.0E-35
sp|P0DMQ6|DHSO_CHICK Sorbitol dehydrogenase OS=Gallus gallus GN=SORD PE=1 SV=1 10 363 5.0E-35
sp|Q02912|DHSO_BOMMO Sorbitol dehydrogenase OS=Bombyx mori GN=SDH PE=2 SV=1 3 375 1.0E-34
sp|Q00796|DHSO_HUMAN Sorbitol dehydrogenase OS=Homo sapiens GN=SORD PE=1 SV=4 7 366 9.0E-33
sp|Q4R639|DHSO_MACFA Sorbitol dehydrogenase OS=Macaca fascicularis GN=SORD PE=2 SV=3 7 366 4.0E-32
sp|P07846|DHSO_SHEEP Sorbitol dehydrogenase OS=Ovis aries GN=SORD PE=1 SV=1 7 356 3.0E-31
sp|Q5R5F3|DHSO_PONAB Sorbitol dehydrogenase OS=Pongo abelii GN=SORD PE=2 SV=1 7 366 4.0E-31
sp|P35497|DHSO1_YEAST Sorbitol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOR1 PE=3 SV=1 55 356 5.0E-31
sp|Q07786|DHSO2_YEAST Sorbitol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOR2 PE=3 SV=1 55 356 5.0E-31
sp|Q58D31|DHSO_BOVIN Sorbitol dehydrogenase OS=Bos taurus GN=SORD PE=2 SV=3 7 356 2.0E-30
sp|Q07993|XYL2_YEAST D-xylulose reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XYL2 PE=1 SV=1 39 356 1.0E-29
sp|Q6L743|DOIAD_STRKN 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces kanamyceticus GN=kanE PE=3 SV=1 1 353 2.0E-29
sp|Q1PSI9|IDND_VITVI L-idonate 5-dehydrogenase OS=Vitis vinifera GN=VIT_16s0100g00290 PE=1 SV=2 55 360 3.0E-29
sp|Q2MFP3|DOIAD_STRRY 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces rimosus subsp. paromomycinus GN=parE PE=3 SV=1 1 353 1.0E-28
sp|Q9FJ95|DHSO_ARATH Sorbitol dehydrogenase OS=Arabidopsis thaliana GN=SDH PE=1 SV=1 55 353 2.0E-28
sp|O35045|YJMD_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YjmD OS=Bacillus subtilis (strain 168) GN=yjmD PE=2 SV=1 39 354 3.0E-28
sp|P27867|DHSO_RAT Sorbitol dehydrogenase OS=Rattus norvegicus GN=Sord PE=1 SV=4 7 366 9.0E-28
sp|Q2MF22|DOIAD_STRSD 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptoalloteichus tenebrarius (strain ATCC 17920 / DSM 40477 / NCIB 11028) GN=tobE PE=3 SV=1 1 353 2.0E-27
sp|Q53U21|DOIAD_STRFR 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces fradiae GN=neoA PE=1 SV=1 1 353 5.0E-27
sp|O58389|TDH_PYRHO Probable L-threonine 3-dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tdh PE=1 SV=1 1 366 8.0E-27
sp|A6WUG6|TDH_SHEB8 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS185) GN=tdh PE=3 SV=1 33 353 9.0E-27
sp|P36624|DHSO_SCHPO Putative sorbitol dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tms1 PE=3 SV=2 11 363 1.0E-26
sp|Q64442|DHSO_MOUSE Sorbitol dehydrogenase OS=Mus musculus GN=Sord PE=1 SV=3 7 356 1.0E-26
sp|A6W1W3|TDH_MARMS L-threonine 3-dehydrogenase OS=Marinomonas sp. (strain MWYL1) GN=tdh PE=3 SV=1 4 356 1.0E-26
sp|Q8R7K0|TDH_CALS4 L-threonine 3-dehydrogenase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tdh PE=3 SV=2 48 376 2.0E-26
sp|Q8U259|TDH_PYRFU Probable L-threonine 3-dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tdh PE=3 SV=1 1 366 2.0E-26
sp|B2SDJ2|TDH_FRATM L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=tdh PE=3 SV=1 33 353 2.0E-26
sp|Q4R0W1|DOIAD_STRRI 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces ribosidificus GN=rbmC PE=3 SV=1 1 353 2.0E-26
sp|Q9UYX0|TDH_PYRAB Probable L-threonine 3-dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tdh PE=3 SV=1 1 366 2.0E-26
sp|Q63PD9|TDH_BURPS L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=tdh PE=3 SV=1 41 364 3.0E-26
sp|A3NF91|TDH_BURP6 L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain 668) GN=tdh PE=3 SV=1 41 364 3.0E-26
sp|Q3JID4|TDH_BURP1 L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=tdh PE=3 SV=1 41 364 3.0E-26
sp|A3P139|TDH_BURP0 L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain 1106a) GN=tdh PE=3 SV=1 41 364 3.0E-26
sp|A1UXP8|TDH_BURMS L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain SAVP1) GN=tdh PE=3 SV=1 41 364 3.0E-26
sp|Q62EL5|TDH_BURMA L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=tdh PE=3 SV=1 41 364 3.0E-26
sp|A2RZW5|TDH_BURM9 L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain NCTC 10229) GN=tdh PE=3 SV=1 41 364 3.0E-26
sp|A3MAC8|TDH_BURM7 L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain NCTC 10247) GN=tdh PE=3 SV=1 41 364 3.0E-26
sp|B0TYR8|TDH_FRAP2 L-threonine 3-dehydrogenase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=tdh PE=3 SV=1 33 353 4.0E-26
sp|Q0BKV5|TDH_FRATO L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=tdh PE=3 SV=1 33 353 5.0E-26
sp|Q2A282|TDH_FRATH L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=tdh PE=3 SV=1 33 353 5.0E-26
sp|A7NDM9|TDH_FRATF L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=tdh PE=3 SV=1 33 353 5.0E-26
sp|A4IZ92|TDH_FRATW L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=tdh PE=3 SV=1 33 353 7.0E-26
sp|Q5NGW4|TDH_FRATT L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=tdh PE=3 SV=1 33 353 7.0E-26
sp|Q14IB6|TDH_FRAT1 L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=tdh PE=3 SV=1 33 353 7.0E-26
sp|Q38ZS8|TDH_BURL3 L-threonine 3-dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tdh PE=3 SV=1 41 364 9.0E-26
sp|A9KWY0|TDH_SHEB9 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS195) GN=tdh PE=3 SV=1 33 353 1.0E-25
sp|A3CYN0|TDH_SHEB5 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tdh PE=3 SV=1 33 353 1.0E-25
sp|B8EDS6|TDH_SHEB2 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS223) GN=tdh PE=3 SV=1 33 353 1.0E-25
sp|B4EFZ7|TDH_BURCJ L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=tdh PE=3 SV=1 41 364 1.0E-25
sp|A0B459|TDH_BURCH L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) GN=tdh PE=3 SV=1 41 364 1.0E-25
sp|B1K269|TDH_BURCC L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) GN=tdh PE=3 SV=1 41 364 1.0E-25
sp|Q1BK24|TDH_BURCA L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) GN=tdh PE=3 SV=1 41 364 1.0E-25
sp|A4YCC5|TDH_SHEPC L-threonine 3-dehydrogenase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tdh PE=3 SV=1 33 353 1.0E-25
sp|A4JKG7|TDH_BURVG L-threonine 3-dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=tdh PE=3 SV=1 41 364 2.0E-25
sp|Q2T9E1|TDH_BURTA L-threonine 3-dehydrogenase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tdh PE=3 SV=1 41 364 2.0E-25
sp|B1YXP0|TDH_BURA4 L-threonine 3-dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) GN=tdh PE=3 SV=1 41 364 2.0E-25
sp|A9AR24|TDH_BURM1 L-threonine 3-dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=tdh PE=3 SV=1 41 364 2.0E-25
sp|Q0B5Q1|TDH_BURCM L-threonine 3-dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=tdh PE=3 SV=1 41 364 2.0E-25
sp|Q8PNN2|TDH_XANAC L-threonine 3-dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tdh PE=3 SV=1 14 358 2.0E-25
sp|Q3IHW0|TDH_PSEHT L-threonine 3-dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tdh PE=3 SV=1 33 364 2.0E-25
sp|A1RE07|TDH_SHESW L-threonine 3-dehydrogenase OS=Shewanella sp. (strain W3-18-1) GN=tdh PE=3 SV=1 33 353 3.0E-25
sp|A0Q5K3|TDH_FRATN L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. novicida (strain U112) GN=tdh PE=3 SV=1 33 353 3.0E-25
sp|A1S1Q3|TDH_SHEAM L-threonine 3-dehydrogenase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tdh PE=3 SV=1 33 364 4.0E-25
sp|Q5QUN8|TDH_IDILO L-threonine 3-dehydrogenase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tdh PE=3 SV=1 48 364 5.0E-25
sp|O34268|TDH_XANCP L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tdh PE=3 SV=1 14 358 5.0E-25
sp|B0RU31|TDH_XANCB L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=tdh PE=3 SV=1 14 358 5.0E-25
sp|Q4URI9|TDH_XANC8 L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tdh PE=3 SV=1 14 358 5.0E-25
sp|P39400|LGOD_ECOLI L-galactonate-5-dehydrogenase OS=Escherichia coli (strain K12) GN=lgoD PE=1 SV=3 55 367 6.0E-25
sp|Q0HPI5|TDH_SHESR L-threonine 3-dehydrogenase OS=Shewanella sp. (strain MR-7) GN=tdh PE=3 SV=1 33 353 6.0E-25
sp|A3QJC8|TDH_SHELP L-threonine 3-dehydrogenase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tdh PE=3 SV=1 33 353 8.0E-25
sp|Q5GWI3|TDH_XANOR L-threonine 3-dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tdh PE=3 SV=2 14 353 1.0E-24
sp|Q2NZP2|TDH_XANOM L-threonine 3-dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tdh PE=3 SV=1 14 353 1.0E-24
sp|Q57517|Y053_HAEIN Uncharacterized zinc-type alcohol dehydrogenase-like protein HI_0053 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0053 PE=3 SV=1 1 372 1.0E-24
sp|Q3BWT0|TDH_XANC5 L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tdh PE=3 SV=1 14 358 1.0E-24
sp|Q15ZU4|TDH_PSEA6 L-threonine 3-dehydrogenase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tdh PE=3 SV=1 48 353 1.0E-24
sp|B6YTJ5|TDH_THEON Probable L-threonine 3-dehydrogenase OS=Thermococcus onnurineus (strain NA1) GN=tdh PE=3 SV=1 56 375 1.0E-24
sp|B2JPU0|TDH_BURP8 L-threonine 3-dehydrogenase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=tdh PE=3 SV=1 41 364 2.0E-24
sp|Q8E8J1|TDH_SHEON L-threonine 3-dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=tdh PE=3 SV=1 33 353 2.0E-24
sp|Q5JI69|TDH_THEKO Probable L-threonine 3-dehydrogenase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tdh PE=1 SV=1 1 377 2.0E-24
sp|P38105|RSPB_ECOLI Starvation-sensing protein RspB OS=Escherichia coli (strain K12) GN=rspB PE=2 SV=1 1 251 2.0E-24
sp|B4S298|TDH_ALTMD L-threonine 3-dehydrogenase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tdh PE=3 SV=1 33 353 3.0E-24
sp|A8GYP8|TDH_SHEPA L-threonine 3-dehydrogenase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tdh PE=3 SV=1 33 364 3.0E-24
sp|Q5SKS4|TDH_THET8 L-threonine 3-dehydrogenase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tdh PE=1 SV=1 1 356 3.0E-24
sp|Q5WYJ7|TDH_LEGPL L-threonine 3-dehydrogenase OS=Legionella pneumophila (strain Lens) GN=tdh PE=3 SV=1 33 353 3.0E-24
sp|Q0HDA3|TDH_SHESM L-threonine 3-dehydrogenase OS=Shewanella sp. (strain MR-4) GN=tdh PE=3 SV=1 33 353 3.0E-24
sp|A0L2Q3|TDH_SHESA L-threonine 3-dehydrogenase OS=Shewanella sp. (strain ANA-3) GN=tdh PE=3 SV=1 33 353 3.0E-24
sp|Q72L62|TDH_THET2 L-threonine 3-dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tdh PE=3 SV=1 1 356 4.0E-24
sp|B2FQN4|TDH_STRMK L-threonine 3-dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) GN=tdh PE=3 SV=1 14 358 4.0E-24
sp|B1KL24|TDH_SHEWM L-threonine 3-dehydrogenase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tdh PE=3 SV=1 33 364 7.0E-24
sp|A5IGK7|TDH_LEGPC L-threonine 3-dehydrogenase OS=Legionella pneumophila (strain Corby) GN=tdh PE=3 SV=1 33 353 7.0E-24
sp|P77280|YDJJ_ECOLI Uncharacterized zinc-type alcohol dehydrogenase-like protein YdjJ OS=Escherichia coli (strain K12) GN=ydjJ PE=3 SV=1 9 367 8.0E-24
sp|Q5ZXM9|TDH_LEGPH L-threonine 3-dehydrogenase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tdh PE=3 SV=2 33 353 8.0E-24
sp|A1JHX8|TDH_YERE8 L-threonine 3-dehydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tdh PE=3 SV=1 33 366 1.0E-23
sp|Q5X748|TDH_LEGPA L-threonine 3-dehydrogenase OS=Legionella pneumophila (strain Paris) GN=tdh PE=3 SV=1 33 353 1.0E-23
sp|P22144|XYL2_PICST D-xylulose reductase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=XYL2 PE=2 SV=1 31 356 2.0E-23
sp|Q48AM4|TDH_COLP3 L-threonine 3-dehydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=tdh PE=3 SV=1 48 364 2.0E-23
sp|Q7MY48|TDH_PHOLL L-threonine 3-dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tdh PE=3 SV=1 16 353 3.0E-23
sp|Q83F39|TDH_COXBU L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tdh PE=3 SV=1 48 366 4.0E-23
sp|A9NA21|TDH_COXBR L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tdh PE=3 SV=1 48 366 4.0E-23
sp|A9KET6|TDH_COXBN L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tdh PE=3 SV=1 48 366 4.0E-23
sp|B6J2S1|TDH_COXB2 L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain CbuG_Q212) GN=tdh PE=3 SV=1 48 366 4.0E-23
sp|B0TNM4|TDH_SHEHH L-threonine 3-dehydrogenase OS=Shewanella halifaxensis (strain HAW-EB4) GN=tdh PE=3 SV=1 33 364 5.0E-23
sp|B2T7X5|TDH_BURPP L-threonine 3-dehydrogenase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=tdh PE=3 SV=1 53 368 5.0E-23
sp|A4SHB7|TDH_AERS4 L-threonine 3-dehydrogenase OS=Aeromonas salmonicida (strain A449) GN=tdh PE=3 SV=1 48 366 5.0E-23
sp|Q07W50|TDH_SHEFN L-threonine 3-dehydrogenase OS=Shewanella frigidimarina (strain NCIMB 400) GN=tdh PE=3 SV=1 33 364 5.0E-23
sp|Q13SG2|TDH_BURXL L-threonine 3-dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=tdh PE=3 SV=1 53 368 9.0E-23
sp|A8FPE0|TDH_SHESH L-threonine 3-dehydrogenase OS=Shewanella sediminis (strain HAW-EB3) GN=tdh PE=3 SV=1 33 364 9.0E-23
sp|Q7NXH5|TDH_CHRVO L-threonine 3-dehydrogenase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tdh PE=3 SV=1 53 364 9.0E-23
sp|A6UBM6|TDH_SINMW L-threonine 3-dehydrogenase OS=Sinorhizobium medicae (strain WSM419) GN=tdh PE=3 SV=1 48 353 2.0E-22
sp|Q1MDT5|TDH_RHIL3 L-threonine 3-dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=tdh PE=3 SV=1 33 353 3.0E-22
sp|B1JQW2|TDH_YERPY L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tdh PE=3 SV=1 48 366 3.0E-22
sp|Q66GC5|TDH_YERPS L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tdh PE=3 SV=1 48 366 3.0E-22
sp|B2JYP4|TDH_YERPB L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=tdh PE=3 SV=1 48 366 3.0E-22
sp|A7FCU5|TDH_YERP3 L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tdh PE=3 SV=1 48 366 3.0E-22
sp|A4TSC6|TDH_YERPP L-threonine 3-dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=tdh PE=3 SV=1 48 366 3.0E-22
sp|Q1CD13|TDH_YERPN L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tdh PE=3 SV=1 48 366 3.0E-22
sp|A9R685|TDH_YERPG L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=tdh PE=3 SV=1 48 366 3.0E-22
sp|Q8ZJN2|TDH_YERPE L-threonine 3-dehydrogenase OS=Yersinia pestis GN=tdh PE=3 SV=1 48 366 3.0E-22
sp|Q1C278|TDH_YERPA L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tdh PE=3 SV=1 48 366 3.0E-22
sp|Q2K618|TDH_RHIEC L-threonine 3-dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tdh PE=3 SV=1 33 353 3.0E-22
sp|C6DIA7|TDH_PECCP L-threonine 3-dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=tdh PE=3 SV=1 33 364 4.0E-22
sp|B7LVH6|TDH_ESCF3 L-threonine 3-dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=tdh PE=3 SV=1 48 364 5.0E-22
sp|A0KQV6|TDH_AERHH L-threonine 3-dehydrogenase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=tdh PE=3 SV=1 48 364 5.0E-22
sp|B3PUI4|TDH_RHIE6 L-threonine 3-dehydrogenase OS=Rhizobium etli (strain CIAT 652) GN=tdh PE=3 SV=1 48 353 5.0E-22
sp|P77539|YDJL_ECOLI Uncharacterized zinc-type alcohol dehydrogenase-like protein YdjL OS=Escherichia coli (strain K12) GN=ydjL PE=3 SV=1 1 351 5.0E-22
sp|P0A9S3|GATD_ECOLI Galactitol-1-phosphate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=gatD PE=1 SV=1 54 256 6.0E-22
sp|P0A9S4|GATD_ECO57 Galactitol-1-phosphate 5-dehydrogenase OS=Escherichia coli O157:H7 GN=gatD PE=3 SV=1 54 256 6.0E-22
sp|C3LWF0|TDH_VIBCM L-threonine 3-dehydrogenase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=tdh PE=3 SV=1 48 353 7.0E-22
sp|Q9KL62|TDH_VIBCH L-threonine 3-dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tdh PE=3 SV=1 48 353 7.0E-22
sp|A5F0N6|TDH_VIBC3 L-threonine 3-dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tdh PE=3 SV=1 48 353 7.0E-22
sp|A8GLC6|TDH_SERP5 L-threonine 3-dehydrogenase OS=Serratia proteamaculans (strain 568) GN=tdh PE=3 SV=1 48 364 7.0E-22
sp|Q6DAT5|TDH_PECAS L-threonine 3-dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tdh PE=3 SV=1 33 364 9.0E-22
sp|P07913|TDH_ECOLI L-threonine 3-dehydrogenase OS=Escherichia coli (strain K12) GN=tdh PE=1 SV=1 48 364 1.0E-21
sp|B1X950|TDH_ECODH L-threonine 3-dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=tdh PE=3 SV=1 48 364 1.0E-21
sp|C4ZXK8|TDH_ECOBW L-threonine 3-dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=tdh PE=3 SV=1 48 364 1.0E-21
sp|Q98D10|XYLD_RHILO Putative D-xylulose reductase OS=Rhizobium loti (strain MAFF303099) GN=mlr4915 PE=3 SV=1 55 356 1.0E-21
sp|O07737|Y1895_MYCTU Probable zinc-binding alcohol dehydrogenase Rv1895 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1895 PE=1 SV=1 1 379 1.0E-21
sp|Q52998|TDH_RHIME L-threonine 3-dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=tdh PE=3 SV=2 48 353 1.0E-21
sp|B5ZXE7|TDH_RHILW L-threonine 3-dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=tdh PE=3 SV=1 33 353 1.0E-21
sp|Q70KF0|DOIAD_MICEC 2-deoxy-scyllo-inosamine dehydrogenase OS=Micromonospora echinospora GN=gacH PE=3 SV=1 1 373 1.0E-21
sp|Q96XE0|ADH_SULTO NAD-dependent alcohol dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=adh PE=1 SV=1 1 374 2.0E-21
sp|C5J3R8|LAD_TALEM L-arabinitol 4-dehydrogenase OS=Talaromyces emersonii GN=lad PE=1 SV=1 55 356 2.0E-21
sp|B5YWB7|TDH_ECO5E L-threonine 3-dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=tdh PE=3 SV=1 48 364 2.0E-21
sp|Q8XEJ1|TDH_ECO57 L-threonine 3-dehydrogenase OS=Escherichia coli O157:H7 GN=tdh PE=3 SV=1 48 364 2.0E-21
sp|B9J738|TDH_AGRRK L-threonine 3-dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=tdh PE=3 SV=1 48 364 2.0E-21
sp|Q1R4X4|TDH_ECOUT L-threonine 3-dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=tdh PE=3 SV=1 48 364 2.0E-21
sp|B1LK55|TDH_ECOSM L-threonine 3-dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=tdh PE=3 SV=1 48 364 2.0E-21
sp|Q8FCA2|TDH_ECOL6 L-threonine 3-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tdh PE=3 SV=1 48 364 2.0E-21
sp|A1AHF3|TDH_ECOK1 L-threonine 3-dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=tdh PE=3 SV=1 48 364 2.0E-21
sp|B7N1S0|TDH_ECO81 L-threonine 3-dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=tdh PE=3 SV=1 48 364 2.0E-21
sp|B7NPC5|TDH_ECO7I L-threonine 3-dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=tdh PE=3 SV=1 48 364 2.0E-21
sp|B7MFI0|TDH_ECO45 L-threonine 3-dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=tdh PE=3 SV=1 48 364 2.0E-21
sp|B7ULH2|TDH_ECO27 L-threonine 3-dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=tdh PE=3 SV=1 48 364 2.0E-21
sp|A1SVW5|TDH_PSYIN L-threonine 3-dehydrogenase OS=Psychromonas ingrahamii (strain 37) GN=tdh PE=3 SV=1 48 366 2.0E-21
sp|B7NES3|TDH_ECOLU L-threonine 3-dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=tdh PE=3 SV=1 48 364 2.0E-21
sp|P59409|TDH_SHIFL L-threonine 3-dehydrogenase OS=Shigella flexneri GN=tdh PE=3 SV=1 48 364 3.0E-21
sp|Q0SYE5|TDH_SHIF8 L-threonine 3-dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=tdh PE=3 SV=1 48 364 3.0E-21
sp|Q31V06|TDH_SHIBS L-threonine 3-dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=tdh PE=3 SV=1 48 364 3.0E-21
sp|B2U5D5|TDH_SHIB3 L-threonine 3-dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=tdh PE=3 SV=1 48 364 3.0E-21
sp|B6I3J6|TDH_ECOSE L-threonine 3-dehydrogenase OS=Escherichia coli (strain SE11) GN=tdh PE=3 SV=1 48 364 3.0E-21
sp|B1IZH4|TDH_ECOLC L-threonine 3-dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tdh PE=3 SV=1 48 364 3.0E-21
sp|Q0TBJ0|TDH_ECOL5 L-threonine 3-dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tdh PE=3 SV=1 48 364 3.0E-21
sp|A8A681|TDH_ECOHS L-threonine 3-dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=tdh PE=3 SV=1 48 364 3.0E-21
sp|B7M4A3|TDH_ECO8A L-threonine 3-dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=tdh PE=3 SV=1 48 364 3.0E-21
sp|B7L742|TDH_ECO55 L-threonine 3-dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=tdh PE=3 SV=1 48 364 3.0E-21
sp|A4W529|TDH_ENT38 L-threonine 3-dehydrogenase OS=Enterobacter sp. (strain 638) GN=tdh PE=3 SV=1 33 364 4.0E-21
sp|Q3YVY1|TDH_SHISS L-threonine 3-dehydrogenase OS=Shigella sonnei (strain Ss046) GN=tdh PE=3 SV=1 48 364 4.0E-21
sp|Q8Z2F4|TDH_SALTI L-threonine 3-dehydrogenase OS=Salmonella typhi GN=tdh PE=3 SV=1 33 364 4.0E-21
sp|Q8ZL52|TDH_SALTY L-threonine 3-dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tdh PE=3 SV=1 33 364 5.0E-21
sp|B4TZV9|TDH_SALSV L-threonine 3-dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=tdh PE=3 SV=1 33 364 5.0E-21
sp|B5BHZ1|TDH_SALPK L-threonine 3-dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=tdh PE=3 SV=1 33 364 5.0E-21
sp|C0Q1V0|TDH_SALPC L-threonine 3-dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=tdh PE=3 SV=1 33 364 5.0E-21
sp|A9MVL0|TDH_SALPB L-threonine 3-dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=tdh PE=3 SV=1 33 364 5.0E-21
sp|Q5PC07|TDH_SALPA L-threonine 3-dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tdh PE=3 SV=1 33 364 5.0E-21
sp|B4SXB9|TDH_SALNS L-threonine 3-dehydrogenase OS=Salmonella newport (strain SL254) GN=tdh PE=3 SV=1 33 364 5.0E-21
sp|B4T9A1|TDH_SALHS L-threonine 3-dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=tdh PE=3 SV=1 33 364 5.0E-21
sp|B5R5E1|TDH_SALEP L-threonine 3-dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=tdh PE=3 SV=1 33 364 5.0E-21
sp|B5FLI6|TDH_SALDC L-threonine 3-dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=tdh PE=3 SV=1 33 364 5.0E-21
sp|Q57IC5|TDH_SALCH L-threonine 3-dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=tdh PE=3 SV=1 33 364 5.0E-21
sp|B5EXC3|TDH_SALA4 L-threonine 3-dehydrogenase OS=Salmonella agona (strain SL483) GN=tdh PE=3 SV=1 33 364 5.0E-21
sp|C5BB99|TDH_EDWI9 L-threonine 3-dehydrogenase OS=Edwardsiella ictaluri (strain 93-146) GN=tdh PE=3 SV=1 48 353 6.0E-21
sp|A6TFL2|TDH_KLEP7 L-threonine 3-dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=tdh PE=3 SV=1 48 364 7.0E-21
sp|B5XTI4|TDH_KLEP3 L-threonine 3-dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=tdh PE=3 SV=1 48 364 7.0E-21
sp|B5RGH0|TDH_SALG2 L-threonine 3-dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=tdh PE=3 SV=1 33 364 8.0E-21
sp|P59410|TDH_VIBPA L-threonine 3-dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tdh PE=3 SV=1 48 356 9.0E-21
sp|Q6LRD9|TDH_PHOPR L-threonine 3-dehydrogenase OS=Photobacterium profundum GN=tdh PE=3 SV=2 48 353 9.0E-21
sp|C3MFH1|TDH_RHISN L-threonine 3-dehydrogenase OS=Rhizobium sp. (strain NGR234) GN=tdh PE=3 SV=1 48 352 1.0E-20
sp|A9MKQ8|TDH_SALAR L-threonine 3-dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=tdh PE=3 SV=1 33 364 1.0E-20
sp|B5ETJ6|TDH_VIBFM L-threonine 3-dehydrogenase OS=Vibrio fischeri (strain MJ11) GN=tdh PE=3 SV=1 48 353 1.0E-20
sp|B6HI95|LAD_PENRW L-arabinitol 4-dehydrogenase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lad1 PE=1 SV=1 55 356 2.0E-20
sp|A7ZTH0|TDH_ECO24 L-threonine 3-dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tdh PE=3 SV=1 48 364 2.0E-20
sp|Q5E0F9|TDH_VIBF1 L-threonine 3-dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=tdh PE=3 SV=1 48 353 2.0E-20
sp|Q329N8|TDH_SHIDS L-threonine 3-dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tdh PE=3 SV=1 48 364 2.0E-20
sp|A7MID0|TDH_CROS8 L-threonine 3-dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=tdh PE=3 SV=1 1 364 2.0E-20
sp|C1D195|TDH_DEIDV L-threonine 3-dehydrogenase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=tdh PE=3 SV=1 16 364 2.0E-20
sp|Q983J7|TDH_RHILO L-threonine 3-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=tdh PE=3 SV=1 48 364 3.0E-20
sp|Q2MF72|DOIAD_STRLV 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces lividus GN=livE PE=3 SV=1 1 353 3.0E-20
sp|Q9L233|TDH_STRCO L-threonine 3-dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tdh PE=3 SV=1 9 323 4.0E-20
sp|B6ESA4|TDH_ALISL L-threonine 3-dehydrogenase OS=Aliivibrio salmonicida (strain LFI1238) GN=tdh PE=3 SV=1 48 353 5.0E-20
sp|B4F134|TDH_PROMH L-threonine 3-dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=tdh PE=3 SV=1 48 353 1.0E-19
sp|Q82MN2|TDH_STRAW L-threonine 3-dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tdh PE=3 SV=1 9 323 2.0E-19
sp|Q65JE7|TDH_BACLD L-threonine 3-dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tdh PE=3 SV=1 39 376 2.0E-19
sp|Q02BT1|TDH_SOLUE L-threonine 3-dehydrogenase OS=Solibacter usitatus (strain Ellin6076) GN=tdh PE=3 SV=1 9 323 2.0E-19
sp|B4UMJ1|TDH_ANASK L-threonine 3-dehydrogenase OS=Anaeromyxobacter sp. (strain K) GN=tdh PE=3 SV=1 44 366 3.0E-19
sp|B8J714|TDH_ANAD2 L-threonine 3-dehydrogenase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=tdh PE=3 SV=1 44 366 3.0E-19
sp|Q763T4|LAD_ASPOZ L-arabinitol 4-dehydrogenase OS=Aspergillus oryzae GN=ladA PE=1 SV=1 33 356 4.0E-19
sp|A2QAC0|LAD_ASPNC L-arabinitol 4-dehydrogenase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ladA PE=1 SV=1 55 356 6.0E-19
sp|B1VWE7|TDH_STRGG L-threonine 3-dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=tdh PE=3 SV=1 33 323 9.0E-19
sp|Q2IJN4|TDH_ANADE L-threonine 3-dehydrogenase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=tdh PE=3 SV=1 44 366 9.0E-19
sp|Q11L77|TDH_CHESB L-threonine 3-dehydrogenase OS=Chelativorans sp. (strain BNC1) GN=tdh PE=3 SV=1 48 356 1.0E-18
sp|Q7SI09|LAD_NEUCR L-arabinitol 4-dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ard-1 PE=1 SV=1 54 356 2.0E-18
sp|Q8D442|TDH_VIBVU L-threonine 3-dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=tdh PE=3 SV=1 48 353 2.0E-18
sp|A8ARK6|TDH_CITK8 L-threonine 3-dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=tdh PE=3 SV=1 48 364 2.0E-18
sp|B7VR52|TDH_VIBTL L-threonine 3-dehydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=tdh PE=3 SV=1 48 353 2.0E-18
sp|Q7MFL5|TDH_VIBVY L-threonine 3-dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=tdh PE=3 SV=1 48 353 3.0E-18
sp|P39346|IDND_ECOLI L-idonate 5-dehydrogenase (NAD(P)(+)) OS=Escherichia coli (strain K12) GN=idnD PE=1 SV=1 48 339 5.0E-18
sp|Q5LN53|TDH_RUEPO L-threonine 3-dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tdh PE=3 SV=2 33 356 8.0E-18
sp|A7HEI5|TDH_ANADF L-threonine 3-dehydrogenase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=tdh PE=3 SV=1 33 364 1.0E-17
sp|Q96V44|LAD_HYPJE L-arabinitol 4-dehydrogenase OS=Hypocrea jecorina GN=lad1 PE=1 SV=1 54 356 2.0E-17
sp|Q8U7Y1|XYLD_AGRFC Putative D-xylulose reductase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu4318 PE=3 SV=1 55 374 3.0E-17
sp|A4FND4|TDH_SACEN L-threonine 3-dehydrogenase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tdh PE=3 SV=1 9 323 3.0E-17
sp|Q67N85|TDH_SYMTH L-threonine 3-dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tdh PE=3 SV=1 48 354 3.0E-17
sp|Q6MD15|TDH_PARUW L-threonine 3-dehydrogenase OS=Protochlamydia amoebophila (strain UWE25) GN=tdh PE=3 SV=1 33 364 4.0E-17
sp|Q59545|XYLD_MORMO D-xylulose reductase OS=Morganella morganii PE=1 SV=1 55 356 7.0E-17
sp|A7Z4X0|TDH_BACMF L-threonine 3-dehydrogenase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=tdh PE=3 SV=1 48 376 1.0E-16
sp|Q92MT4|XYLD_RHIME Putative D-xylulose reductase OS=Rhizobium meliloti (strain 1021) GN=R02526 PE=3 SV=1 55 355 4.0E-16
sp|P77360|YPHC_ECOLI Uncharacterized zinc-type alcohol dehydrogenase-like protein YphC OS=Escherichia coli (strain K12) GN=yphC PE=3 SV=2 39 277 1.0E-15
sp|Q9RTU4|TDH_DEIRA L-threonine 3-dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tdh PE=3 SV=2 48 364 1.0E-15
sp|P42328|ADH3_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 27 344 7.0E-15
sp|Q6AAR3|TDH_PROAC L-threonine 3-dehydrogenase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tdh PE=3 SV=1 9 356 1.0E-14
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 27 360 2.0E-14
sp|Q4J781|ADH_SULAC NAD-dependent alcohol dehydrogenase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=adh PE=3 SV=1 1 353 6.0E-14
sp|O31776|TDH_BACSU L-threonine 3-dehydrogenase OS=Bacillus subtilis (strain 168) GN=tdh PE=3 SV=1 48 364 1.0E-13
sp|O06012|ADHB_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein AdhB OS=Bacillus subtilis (strain 168) GN=adhB PE=3 SV=2 1 279 3.0E-13
sp|A4YGN0|SUCD_METS5 Succinate-semialdehyde dehydrogenase (acetylating) OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1424 PE=1 SV=1 1 376 5.0E-13
sp|P39462|ADH_SULSO NAD-dependent alcohol dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=adh PE=1 SV=1 48 356 7.0E-13
sp|Q4R0J7|ARD1_UROFA D-arabinitol dehydrogenase 1 OS=Uromyces fabae GN=ARD1 PE=1 SV=1 48 377 1.0E-12
sp|Q9HTE3|FADH_PSEAE Glutathione-independent formaldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fdhA PE=3 SV=1 6 277 1.0E-12
sp|P42327|ADH2_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 55 343 1.0E-12
sp|F0QYK7|GLCD2_VULM7 Glucose 1-dehydrogenase 2 OS=Vulcanisaeta moutnovskia (strain 768-28) GN=gdh2 PE=3 SV=2 9 305 1.0E-12
sp|P77316|YBDR_ECOLI Uncharacterized zinc-type alcohol dehydrogenase-like protein YbdR OS=Escherichia coli (strain K12) GN=ybdR PE=3 SV=1 1 381 3.0E-12
sp|P41681|ADH6_PERMA Alcohol dehydrogenase 6 OS=Peromyscus maniculatus GN=ADH6 PE=2 SV=1 38 356 5.0E-12
sp|P50381|ADH_SULSR NAD-dependent alcohol dehydrogenase OS=Sulfolobus sp. (strain RC3) GN=adh PE=3 SV=1 1 356 2.0E-11
sp|A8M8R2|GLCD1_CALMQ Glucose 1-dehydrogenase 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=gdh1 PE=3 SV=2 9 356 3.0E-11
sp|P0CH37|ADHC2_MYCS2 NADP-dependent alcohol dehydrogenase C 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhC2 PE=1 SV=1 49 380 2.0E-10
sp|P0CH36|ADHC1_MYCS2 NADP-dependent alcohol dehydrogenase C 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhc1 PE=1 SV=1 49 380 2.0E-10
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 1 376 4.0E-10
sp|P42734|CADH9_ARATH Probable cinnamyl alcohol dehydrogenase 9 OS=Arabidopsis thaliana GN=CAD9 PE=2 SV=2 55 345 1.0E-09
sp|P9WQC7|ADHB_MYCTU Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhB PE=1 SV=1 26 367 4.0E-09
sp|P9WQC6|ADHB_MYCTO Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhB PE=3 SV=1 26 367 4.0E-09
sp|Q7U1B9|ADHB_MYCBO Alcohol dehydrogenase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhB PE=3 SV=1 26 367 4.0E-09
sp|Q6L1C8|GLCD1_PICTO Glucose 1-dehydrogenase 1 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=gdh1 PE=3 SV=1 54 366 4.0E-09
sp|P9WQC5|ADHC_MYCTU NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhC PE=1 SV=1 55 299 4.0E-09
sp|P9WQC4|ADHC_MYCTO NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhC PE=3 SV=1 55 299 4.0E-09
sp|P0A4X1|ADHC_MYCBO NADP-dependent alcohol dehydrogenase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhC PE=3 SV=1 55 299 4.0E-09
sp|Q45604|YYCR_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YycR OS=Bacillus subtilis (strain 168) GN=yycR PE=3 SV=1 2 278 6.0E-09
sp|Q5XI95|ADH6_RAT Alcohol dehydrogenase 6 OS=Rattus norvegicus GN=Adh6 PE=2 SV=1 38 356 7.0E-09
sp|P80094|FADH_AMYME S-(hydroxymethyl)mycothiol dehydrogenase OS=Amycolatopsis methanolica PE=1 SV=2 81 354 8.0E-09
sp|Q337Y2|CADH3_ORYSJ Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CAD3 PE=2 SV=1 55 262 1.0E-08
sp|C0SPA5|ADHA_BACSU Probable formaldehyde dehydrogenase AdhA OS=Bacillus subtilis (strain 168) GN=adhA PE=2 SV=1 48 363 2.0E-08
sp|O31186|ADHA_RHIME Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 12 338 2.0E-08
sp|Q703W7|GLCDH_THETK Glucose 1-dehydrogenase OS=Thermoproteus tenax (strain ATCC 35583 / NBRC 100435 / JCM 9277 / Kra 1) GN=gdh PE=1 SV=1 9 356 3.0E-08
sp|B2NI93|GEDH_CARLC Geraniol dehydrogenase OS=Carpoglyphus lactis GN=gedh PE=1 SV=2 37 356 4.0E-08
sp|Q97U21|GLCD3_SULSO Glucose 1-dehydrogenase 3 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gdh3 PE=3 SV=1 54 262 5.0E-08
sp|Q0J6T3|CADH5_ORYSJ Putative cinnamyl alcohol dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=CAD5 PE=3 SV=2 55 247 6.0E-08
sp|Q02972|CADH8_ARATH Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis thaliana GN=CAD8 PE=1 SV=1 55 346 8.0E-08
sp|Q9SJ25|CADH2_ARATH Cinnamyl alcohol dehydrogenase 2 OS=Arabidopsis thaliana GN=CAD2 PE=1 SV=1 31 345 9.0E-08
sp|D1YUK8|GLCDH_METPS Glucose 1-dehydrogenase OS=Methanocella paludicola (strain DSM 17711 / JCM 13418 / NBRC 101707 / SANAE) GN=gdh PE=3 SV=1 86 232 2.0E-07
sp|P49384|ADH3_KLULA Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 6 344 5.0E-07
sp|P11766|ADHX_HUMAN Alcohol dehydrogenase class-3 OS=Homo sapiens GN=ADH5 PE=1 SV=4 26 354 9.0E-07
sp|P20369|ADH1_KLULA Alcohol dehydrogenase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH1 PE=3 SV=1 6 339 9.0E-07
sp|P19854|ADHX_HORSE Alcohol dehydrogenase class-3 OS=Equus caballus GN=ADH5 PE=1 SV=2 26 356 9.0E-07
sp|P00331|ADH2_YEAST Alcohol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH2 PE=1 SV=3 6 293 1.0E-06
sp|Q9SJ10|CADH3_ARATH Cinnamyl alcohol dehydrogenase 3 OS=Arabidopsis thaliana GN=CAD3 PE=1 SV=1 31 345 1.0E-06
sp|Q43137|MTDH1_STYHU Probable mannitol dehydrogenase 1 OS=Stylosanthes humilis GN=CAD1 PE=2 SV=1 55 198 1.0E-06
sp|P00330|ADH1_YEAST Alcohol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH1 PE=1 SV=5 6 293 1.0E-06
sp|P78870|FADH1_SCHPO Probable S-(hydroxymethyl)glutathione dehydrogenase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1539.07c PE=2 SV=2 2 354 2.0E-06
sp|Q17334|ADH1_CAEEL Alcohol dehydrogenase 1 OS=Caenorhabditis elegans GN=sodh-1 PE=2 SV=2 10 159 2.0E-06
sp|Q0W5A6|GLCDH_METAR Glucose 1-dehydrogenase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=gdh PE=3 SV=1 1 236 2.0E-06
sp|P46154|FADH_PSEPU Glutathione-independent formaldehyde dehydrogenase OS=Pseudomonas putida GN=fdhA PE=1 SV=3 6 277 2.0E-06
sp|P33010|TERPD_PSESP Probable alcohol dehydrogenase OS=Pseudomonas sp. GN=terPD PE=3 SV=1 84 323 2.0E-06
sp|A4YGA7|GLCDH_METS5 Glucose 1-dehydrogenase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=gdh PE=3 SV=1 54 244 3.0E-06
sp|Q8H859|CADH1_ORYSJ Probable cinnamyl alcohol dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=CAD1 PE=2 SV=1 32 374 3.0E-06
sp|O82515|MTDH_MEDSA Probable mannitol dehydrogenase OS=Medicago sativa GN=CAD1 PE=1 SV=1 55 198 4.0E-06
sp|Q07288|ADH1_KLUMA Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus GN=ADH1 PE=3 SV=1 6 346 5.0E-06
sp|O82035|CADH2_PICAB Probable cinnamyl alcohol dehydrogenase 2 OS=Picea abies GN=CAD2 PE=3 SV=1 55 345 7.0E-06
sp|Q08350|CADH7_PICAB Probable cinnamyl alcohol dehydrogenase 7/8 OS=Picea abies GN=CAD7 PE=2 SV=1 55 345 7.0E-06
sp|P38113|ADH5_YEAST Alcohol dehydrogenase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH5 PE=1 SV=1 6 339 1.0E-05
sp|Q6XQ67|ADH5_SACPS Alcohol dehydrogenase 5 OS=Saccharomyces pastorianus GN=ADH5 PE=3 SV=1 6 339 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|114820
MKAARYYGPGDLRVEDIPEPVPTDGQVKVKIAWYVNNPPRISRVTSPLFSANRNGICGSDLHAYLSQTPTYASTE
PHPITQETVPVTLGHEFSGTIVEIGPGVDTTKWATGTNVVIEPVLGCMKGECDTCCQGYRNLCPQITFIGIGGWG
GGLAEYIAVNVRYLHALPEGISLEIGACIEPLAVAYHAVKRSGFTGDGAVLVIGAGPIGLFVVKILRSLYPSITI
LVSEPATIRREFAIKHGATRAFDPTKVNVPDAVRSIISPGVDVAFDAAGIQASMDASLFSLRARGTYVNLAIWEK
DAILNVNLILVREINFTGIVGYDRVHEEVISLIASGKIKGIDELITKRISLDDVVEEGIKKLLSEKDKHMKILVH
PGSRSSTL*
Coding >AgabiH97|114820
ATGAAAGCTGCGAGGTACTACGGACCGGGAGACTTACGAGTTGAAGACATTCCGGAGCCTGTTCCCACAGACGGT
CAGGTTAAAGTCAAGATTGCTTGGTACGTGAACAATCCTCCTCGAATTTCAAGAGTAACCTCACCACTCTTCTCT
GCGAATAGGAATGGAATCTGTGGAAGCGACCTTCATGCGTACTTGAGCCAAACACCTACTTACGCGTCTACCGAG
CCACATCCAATTACGCAAGAAACCGTTCCTGTCACTCTTGGTCATGAGTTCTCCGGGACCATAGTCGAAATTGGT
CCAGGAGTCGACACGACCAAATGGGCTACCGGCACAAATGTCGTAATTGAGCCAGTTTTAGGTTGCATGAAAGGA
GAGTGTGATACGTGTTGTCAAGGCTATCGTAATCTCTGCCCTCAGATAACTTTCATTGGAATTGGGGGCTGGGGA
GGGGGCCTTGCGGAATACATCGCCGTAAATGTGCGATATTTGCATGCGCTTCCAGAAGGGATATCCTTGGAAATT
GGGGCCTGTATCGAACCTCTCGCTGTAGCATATCACGCCGTCAAGAGGTCAGGATTCACTGGGGATGGGGCTGTT
CTCGTCATTGGTGCAGGGCCAATAGGATTATTCGTTGTCAAAATACTCAGGTCACTCTATCCGTCTATCACCATT
CTGGTATCCGAACCAGCAACTATACGGCGTGAATTTGCCATCAAACATGGTGCAACGCGGGCGTTCGACCCAACC
AAAGTCAATGTACCTGATGCTGTCAGGTCGATTATCAGTCCAGGTGTTGACGTTGCCTTTGACGCTGCAGGAATC
CAGGCTTCCATGGACGCATCTCTATTCAGTCTGCGCGCCAGAGGAACTTATGTCAACCTTGCCATATGGGAGAAA
GATGCAATTCTCAATGTCAACTTAATTCTGGTACGAGAAATAAACTTTACTGGCATTGTGGGATATGATCGTGTC
CACGAGGAGGTTATTTCATTAATTGCCTCCGGAAAAATCAAAGGCATCGATGAATTGATCACGAAACGGATCTCT
CTCGACGACGTCGTGGAAGAGGGGATTAAAAAGCTTCTATCAGAGAAAGACAAGCATATGAAAATACTTGTTCAC
CCCGGAAGTCGTTCATCAACTTTGTGA
Transcript >AgabiH97|114820
ATGAAAGCTGCGAGGTACTACGGACCGGGAGACTTACGAGTTGAAGACATTCCGGAGCCTGTTCCCACAGACGGT
CAGGTTAAAGTCAAGATTGCTTGGTACGTGAACAATCCTCCTCGAATTTCAAGAGTAACCTCACCACTCTTCTCT
GCGAATAGGAATGGAATCTGTGGAAGCGACCTTCATGCGTACTTGAGCCAAACACCTACTTACGCGTCTACCGAG
CCACATCCAATTACGCAAGAAACCGTTCCTGTCACTCTTGGTCATGAGTTCTCCGGGACCATAGTCGAAATTGGT
CCAGGAGTCGACACGACCAAATGGGCTACCGGCACAAATGTCGTAATTGAGCCAGTTTTAGGTTGCATGAAAGGA
GAGTGTGATACGTGTTGTCAAGGCTATCGTAATCTCTGCCCTCAGATAACTTTCATTGGAATTGGGGGCTGGGGA
GGGGGCCTTGCGGAATACATCGCCGTAAATGTGCGATATTTGCATGCGCTTCCAGAAGGGATATCCTTGGAAATT
GGGGCCTGTATCGAACCTCTCGCTGTAGCATATCACGCCGTCAAGAGGTCAGGATTCACTGGGGATGGGGCTGTT
CTCGTCATTGGTGCAGGGCCAATAGGATTATTCGTTGTCAAAATACTCAGGTCACTCTATCCGTCTATCACCATT
CTGGTATCCGAACCAGCAACTATACGGCGTGAATTTGCCATCAAACATGGTGCAACGCGGGCGTTCGACCCAACC
AAAGTCAATGTACCTGATGCTGTCAGGTCGATTATCAGTCCAGGTGTTGACGTTGCCTTTGACGCTGCAGGAATC
CAGGCTTCCATGGACGCATCTCTATTCAGTCTGCGCGCCAGAGGAACTTATGTCAACCTTGCCATATGGGAGAAA
GATGCAATTCTCAATGTCAACTTAATTCTGGTACGAGAAATAAACTTTACTGGCATTGTGGGATATGATCGTGTC
CACGAGGAGGTTATTTCATTAATTGCCTCCGGAAAAATCAAAGGCATCGATGAATTGATCACGAAACGGATCTCT
CTCGACGACGTCGTGGAAGAGGGGATTAAAAAGCTTCTATCAGAGAAAGACAAGCATATGAAAATACTTGTTCAC
CCCGGAAGTCGTTCATCAACTTTGTGA
Gene >AgabiH97|114820
ATGAAAGCTGCGAGGTACTACGGACCGGGAGACTTACGAGTTGAAGACATTCCGGAGCCTGTTCCCACAGACGGT
CAGGTTAAAGTCAAGGTAACTCCATTTTCGAATTTATTGACTTCTATTGCTACACAAATCGTAGATTGCTTGGTA
CGTGAACAATCCTCCTCGAATTTCAAGAGTAACCTCACCACTCTTCTCTGCGAATAGGAATGGAAGTAAGATTTC
ATCCACCTCCTCCTCGATATATATTTGTCCCCTGAGTGTCGATCTCAACAGTCTGTGGAAGCGACCTTCATGCGT
ACTTGAGCCAAACACCTACTTACGCGTCTACCGAGCCACATCCAATTACGCAAGAAACCGTTCCTGTCACTCTTG
GTCATGAGTAAGGGTGTTCGATAGGTATTTCCCGGAGATTCTCAAATCCTCTCAGGTTCTCCGGGACCATAGTCG
AAATTGGTCCAGGAGTCGACACGACCAAATGGGCTACCGGCACAAATGTCGTAATGTAAACTTTCCGATTTGGCC
AATATGACTATATTCATCAGTAAAAATCCTCAGTGAGCCAGTTTTAGGTTGCATGAAAGGAGAGTGTGATACGTG
TTGTCAAGGCTATCGTAATCTCTGCCCTCAGATAACTTTCATTGTAAGTTAGGTTTTTGATTACTGCTACTTCAT
GAGTTTACATATAATCAACCGATAATAGGGAATTGGGGGCTGGGGAGGGGGCCTTGCGGAATACATCGCCGTAAA
TGTGCGATATTTGCATGCGCTTCCAGAAGGGATATCCTGTACGTTTCTTTCACGTTCTGTTTGTTGATTCTGGAT
CACTAAGCCATTGTAGTGGAAATTGGGGCCTGTATCGAACCTCTCGCTGTAGCATATCACGCCGTCAAGAGGTCA
GGATTCACTGGGGATGGGGCTGTTCTCGTCATTGGTGCAGGGCCAGTGAGTTGCTCTAATTATGTTCCTTTTTCC
TTCTTTTGTCCGATGTCATCTTTCAGATAGGATTATTCGTTGTCAAAATACTCAGGTGAGATTATTCAGTTCCTG
TCTAGCCCATACGTAGTAGGGATTGACTCCAGGCGCTCATTTAGGTCACTCTATCCGTCTATCACCATTCTGGTA
TCCGAACCAGCAACTATACGGCGTGAATTTGCCATCAAACATGGTGCAACGCGGGCGTTCGACCCAACCAAAGTC
AATGTACCTGATGCTGTCAGGTCGATTATCAGTCCAGGTGTTGACGTTGCCTTTGACGCTGCAGGAATCCAGGCT
TCCATGGACGCATCTCTATTCAGTCTGCGCGCCAGAGGAACTTATGTCAACCTTGCCATATGGGAGAAAGATGCA
ATTCTCAATGTCAACTTAATTCTGGTACGAGAAATAAACTTTACTGGTAAGTCGAATGCTTTACAGTTTCTTCAT
ATCTTGCTTTGACGTTTTTGAACTCAAGGCATTGTGGGATATGATCGTGTCCACGAGGAGGTTATTTCATTAATT
GCCTCCGGAAAAATCAAAGGCATCGATGAATTGATCACGAAACGGATCTCTCTCGACGACGTCGTGGAAGAGGGG
ATTAAAAAGCTTCTATCAGAGAAAGACAAGCATAGTCAGTGTCATTGAAATATTTCTGACGAGCTCTGCCTAAGC
GTTGATTTGACAGTGAAAATACTTGTTCACCCCGGAAGTCGTTCATCAACTTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail