Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|114680
Gene name
Locationscaffold_9:288536..291843
Strand-
Gene length (bp)3307
Transcript length (bp)2763
Coding sequence length (bp)2763
Protein length (aa) 921

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.5E-63 29 332
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 3.6E-43 34 285
PF12063 DUF3543 Domain of unknown function (DUF3543) 4.0E-40 643 869

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CP71|ATG1_CRYNB Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG1 PE=3 SV=1 29 396 7.0E-121
sp|P0CP70|ATG1_CRYNJ Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG1 PE=3 SV=1 29 396 7.0E-121
sp|A7KAL2|ATG1_PENRW Serine/threonine-protein kinase atg1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg1 PE=3 SV=1 29 871 1.0E-106
sp|A1CX69|ATG1_NEOFI Serine/threonine-protein kinase atg1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg1 PE=3 SV=1 29 871 1.0E-104
sp|Q4WPF2|ATG1_ASPFU Serine/threonine-protein kinase atg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg1 PE=3 SV=1 29 835 2.0E-104
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CP71|ATG1_CRYNB Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG1 PE=3 SV=1 29 396 7.0E-121
sp|P0CP70|ATG1_CRYNJ Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG1 PE=3 SV=1 29 396 7.0E-121
sp|A7KAL2|ATG1_PENRW Serine/threonine-protein kinase atg1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg1 PE=3 SV=1 29 871 1.0E-106
sp|A1CX69|ATG1_NEOFI Serine/threonine-protein kinase atg1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg1 PE=3 SV=1 29 871 1.0E-104
sp|Q4WPF2|ATG1_ASPFU Serine/threonine-protein kinase atg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg1 PE=3 SV=1 29 835 2.0E-104
sp|Q0CLX3|ATG1_ASPTN Serine/threonine-protein kinase atg1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg1 PE=3 SV=1 29 871 3.0E-104
sp|A2QIL5|ATG1_ASPNC Serine/threonine-protein kinase atg1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg1 PE=3 SV=1 29 836 6.0E-104
sp|Q4P0K0|ATG1_USTMA Serine/threonine-protein kinase ATG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG1 PE=2 SV=1 29 571 4.0E-102
sp|Q2UGZ7|ATG1_ASPOR Serine/threonine-protein kinase atg1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg1 PE=3 SV=1 29 822 1.0E-100
sp|Q1DN93|ATG1_COCIM Serine/threonine-protein kinase ATG1 OS=Coccidioides immitis (strain RS) GN=ATG1 PE=3 SV=1 26 871 8.0E-100
sp|Q5BCU8|ATG1_EMENI Serine/threonine-protein kinase atg1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg1 PE=3 SV=1 28 871 5.0E-97
sp|Q8TFN2|ATG1_PICAN Serine/threonine-protein kinase ATG1 OS=Pichia angusta GN=ATG1 PE=3 SV=1 24 869 6.0E-96
sp|A1CHL6|ATG1_ASPCL Serine/threonine-protein kinase atg1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg1 PE=3 SV=1 29 335 8.0E-94
sp|Q9Y7T4|ATG1_SCHPO Serine/threonine-protein kinase atg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg1 PE=1 SV=1 24 332 3.0E-93
sp|Q6BS08|ATG1_DEBHA Serine/threonine-protein kinase ATG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG1 PE=3 SV=2 29 331 9.0E-93
sp|Q5A649|ATG1_CANAL Serine/threonine-protein kinase ATG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG1 PE=3 SV=1 29 335 7.0E-91
sp|Q6H9I1|ATG1_BOTFU Serine/threonine-protein kinase ATG1 OS=Botryotinia fuckeliana GN=atg1 PE=3 SV=1 29 835 9.0E-91
sp|A6RYB8|ATG1_BOTFB Serine/threonine-protein kinase atg1 OS=Botryotinia fuckeliana (strain B05.10) GN=atg1 PE=3 SV=1 29 835 9.0E-91
sp|Q0UY20|ATG1_PHANO Serine/threonine-protein kinase atg1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG1 PE=3 SV=2 35 331 3.0E-89
sp|P87248|ATG1_COLLN Serine/threonine-protein kinase ATG1 OS=Colletotrichum lindemuthianum GN=ATG1 PE=3 SV=1 12 331 5.0E-88
sp|A7F0W2|ATG1_SCLS1 Serine/threonine-protein kinase ATG1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ATG1 PE=3 SV=1 29 849 6.0E-88
sp|Q6C7U0|ATG1_YARLI Serine/threonine-protein kinase ATG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG1 PE=3 SV=1 26 520 8.0E-88
sp|Q8TGI1|ATG1_PICPA Serine/threonine-protein kinase ATG1 OS=Komagataella pastoris GN=ATG1 PE=3 SV=1 29 331 7.0E-87
sp|Q2H6X2|ATG1_CHAGB Serine/threonine-protein kinase ATG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG1 PE=3 SV=1 29 834 7.0E-87
sp|Q52EB3|ATG1_MAGO7 Serine/threonine-protein kinase ATG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG1 PE=1 SV=1 29 330 2.0E-86
sp|Q3ZDQ4|ATG1_PODAS Serine/threonine-protein kinase ATG1 OS=Podospora anserina GN=ATG1 PE=2 SV=1 12 361 4.0E-86
sp|Q7RX99|ATG1_NEUCR Serine/threonine-protein kinase apg-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-1 PE=3 SV=2 29 331 5.0E-84
sp|Q6CSX2|ATG1_KLULA Serine/threonine-protein kinase ATG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG1 PE=3 SV=1 29 426 4.0E-80
sp|Q6FL58|ATG1_CANGA Serine/threonine-protein kinase ATG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG1 PE=3 SV=1 29 370 1.0E-79
sp|P53104|ATG1_YEAST Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG1 PE=1 SV=1 29 330 5.0E-79
sp|A6ZU07|ATG1_YEAS7 Serine/threonine-protein kinase ATG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG1 PE=3 SV=1 29 330 5.0E-79
sp|Q75CH3|ATG1_ASHGO Serine/threonine-protein kinase ATG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG1 PE=3 SV=1 29 336 1.0E-78
sp|A7TIZ4|ATG1_VANPO Serine/threonine-protein kinase atg1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG1 PE=3 SV=1 29 332 4.0E-77
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 31 331 4.0E-67
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 29 331 7.0E-64
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 8 331 7.0E-63
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 22 330 6.0E-55
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 29 335 7.0E-55
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 26 330 8.0E-55
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 22 330 2.0E-54
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 29 330 4.0E-54
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 26 330 4.0E-53
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 31 280 6.0E-50
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 31 280 3.0E-49
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 35 289 4.0E-47
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 35 289 4.0E-47
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 1 330 8.0E-44
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 26 293 1.0E-42
sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 35 281 2.0E-41
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 23 329 7.0E-40
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 23 329 8.0E-40
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 23 329 8.0E-40
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 23 351 3.0E-39
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 23 351 3.0E-39
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 23 351 5.0E-39
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 29 330 4.0E-37
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 29 330 5.0E-37
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 29 330 6.0E-37
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 29 330 7.0E-37
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 29 330 7.0E-37
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 29 330 9.0E-37
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 29 284 3.0E-36
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 29 330 3.0E-36
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 29 330 4.0E-36
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 22 351 5.0E-36
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 29 330 5.0E-36
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 29 330 1.0E-35
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 29 278 1.0E-35
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 29 278 2.0E-35
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 29 278 2.0E-35
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 21 351 3.0E-35
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 7 325 4.0E-35
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 34 274 5.0E-35
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 29 274 6.0E-35
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 29 274 1.0E-34
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 34 285 2.0E-34
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 21 351 3.0E-34
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 29 285 3.0E-34
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 29 329 5.0E-34
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 29 329 6.0E-34
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 26 329 6.0E-34
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 27 325 6.0E-34
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 26 274 9.0E-34
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 29 345 1.0E-33
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 26 330 1.0E-33
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 29 331 2.0E-33
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 35 433 2.0E-33
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 35 274 2.0E-33
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 22 284 3.0E-33
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 35 331 3.0E-33
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 29 331 3.0E-33
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 29 339 4.0E-33
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 29 277 6.0E-33
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 29 343 6.0E-33
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 29 275 7.0E-33
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 29 264 7.0E-33
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 26 330 8.0E-33
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 29 331 1.0E-32
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 35 331 1.0E-32
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 35 341 2.0E-32
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 18 335 2.0E-32
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 35 323 2.0E-32
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 35 344 3.0E-32
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 26 330 4.0E-32
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 26 278 5.0E-32
sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PK2 PE=2 SV=1 29 325 5.0E-32
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 35 331 5.0E-32
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 35 353 6.0E-32
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 35 339 6.0E-32
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 26 330 6.0E-32
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 26 278 6.0E-32
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 29 329 8.0E-32
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 29 328 9.0E-32
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 35 337 9.0E-32
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 10 323 1.0E-31
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 29 343 1.0E-31
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 1 331 1.0E-31
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 13 283 1.0E-31
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 35 329 2.0E-31
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 35 329 2.0E-31
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 35 332 2.0E-31
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 35 283 2.0E-31
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 29 323 2.0E-31
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 26 345 3.0E-31
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 35 277 3.0E-31
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 35 274 3.0E-31
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 35 283 3.0E-31
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 13 274 4.0E-31
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 13 274 4.0E-31
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 13 274 4.0E-31
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 35 323 4.0E-31
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 35 341 4.0E-31
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 29 274 5.0E-31
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 35 274 5.0E-31
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 1 339 5.0E-31
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 35 323 5.0E-31
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 22 330 5.0E-31
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 15 274 5.0E-31
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 35 278 6.0E-31
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 13 274 6.0E-31
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 15 274 6.0E-31
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 35 278 6.0E-31
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 1 283 6.0E-31
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 1 283 6.0E-31
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 35 330 7.0E-31
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 29 323 7.0E-31
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 17 283 8.0E-31
sp|Q5UQ78|YR517_MIMIV Putative serine/threonine-protein kinase R517/R518 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R517 PE=3 SV=2 35 287 9.0E-31
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 35 283 9.0E-31
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 20 328 1.0E-30
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 35 325 1.0E-30
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 15 283 1.0E-30
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 15 333 1.0E-30
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 29 267 1.0E-30
sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens GN=CDK5 PE=1 SV=3 26 328 2.0E-30
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 18 274 2.0E-30
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 22 274 2.0E-30
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 15 274 2.0E-30
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 32 274 2.0E-30
sp|P49615|CDK5_MOUSE Cyclin-dependent-like kinase 5 OS=Mus musculus GN=Cdk5 PE=1 SV=1 26 328 2.0E-30
sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus GN=CDK5 PE=1 SV=2 26 328 2.0E-30
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 15 274 2.0E-30
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 15 274 2.0E-30
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 4 284 3.0E-30
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 22 331 3.0E-30
sp|O54863|TSSK2_MOUSE Testis-specific serine/threonine-protein kinase 2 OS=Mus musculus GN=Tssk2 PE=1 SV=2 27 380 3.0E-30
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 29 284 3.0E-30
sp|P11837|NIMA_EMENI G2-specific protein kinase nimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimA PE=1 SV=1 29 284 3.0E-30
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 26 323 3.0E-30
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 35 283 4.0E-30
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 35 284 4.0E-30
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 28 277 5.0E-30
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 29 331 5.0E-30
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 29 290 5.0E-30
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 29 278 5.0E-30
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 35 284 5.0E-30
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 35 338 6.0E-30
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 35 342 6.0E-30
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 29 284 7.0E-30
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 35 283 7.0E-30
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 1 284 7.0E-30
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 29 329 7.0E-30
sp|Q3SYZ2|MAPK3_BOVIN MAP kinase-activated protein kinase 3 OS=Bos taurus GN=MAPKAPK3 PE=2 SV=1 3 331 8.0E-30
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 35 327 9.0E-30
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 26 290 9.0E-30
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 29 330 9.0E-30
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 16 275 1.0E-29
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 29 343 1.0E-29
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 22 323 1.0E-29
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 35 331 1.0E-29
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 35 262 1.0E-29
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 35 342 1.0E-29
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 26 328 1.0E-29
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 1 323 1.0E-29
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 29 329 1.0E-29
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 26 278 1.0E-29
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 21 275 1.0E-29
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 7 356 2.0E-29
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 35 278 2.0E-29
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 26 328 2.0E-29
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 32 323 2.0E-29
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 26 278 2.0E-29
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 29 331 2.0E-29
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 35 353 2.0E-29
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 35 264 2.0E-29
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 35 341 2.0E-29
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 29 328 3.0E-29
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 29 328 3.0E-29
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 35 323 3.0E-29
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 35 341 3.0E-29
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 29 328 3.0E-29
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 23 277 4.0E-29
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 29 328 4.0E-29
sp|Q9D411|TSSK4_MOUSE Testis-specific serine/threonine-protein kinase 4 OS=Mus musculus GN=Tssk4 PE=2 SV=1 10 326 4.0E-29
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 35 341 4.0E-29
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 24 288 4.0E-29
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 21 323 4.0E-29
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 35 341 4.0E-29
sp|P48609|CDK5_DROME Cyclin-dependent kinase 5 homolog OS=Drosophila melanogaster GN=Cdk5 PE=1 SV=2 35 289 4.0E-29
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 7 328 5.0E-29
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 27 341 6.0E-29
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 29 328 6.0E-29
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 28 337 6.0E-29
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 28 337 6.0E-29
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 35 323 6.0E-29
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 32 323 6.0E-29
sp|Q61241|TSSK1_MOUSE Testis-specific serine/threonine-protein kinase 1 OS=Mus musculus GN=Tssk1b PE=1 SV=2 21 283 7.0E-29
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 35 323 7.0E-29
sp|O13945|PPK9_SCHPO Protein kinase domain-containing protein ppk9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk9 PE=3 SV=1 11 262 7.0E-29
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 29 278 7.0E-29
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 20 262 8.0E-29
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 35 330 8.0E-29
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 32 283 8.0E-29
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 29 323 9.0E-29
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 24 262 9.0E-29
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 22 274 9.0E-29
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 21 337 9.0E-29
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 35 262 1.0E-28
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 2 330 1.0E-28
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 35 323 1.0E-28
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 35 262 1.0E-28
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 35 323 1.0E-28
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 35 323 1.0E-28
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 35 323 1.0E-28
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 29 328 1.0E-28
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 7 356 1.0E-28
sp|Q3SZW1|TSSK1_BOVIN Testis-specific serine/threonine-protein kinase 1 OS=Bos taurus GN=TSSK1B PE=2 SV=1 21 283 1.0E-28
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 29 328 1.0E-28
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 29 331 1.0E-28
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 29 289 2.0E-28
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 1 325 2.0E-28
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 29 277 2.0E-28
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 23 277 2.0E-28
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 20 262 2.0E-28
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 29 328 2.0E-28
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 29 328 2.0E-28
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 32 323 2.0E-28
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 29 289 2.0E-28
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 22 330 2.0E-28
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 35 330 2.0E-28
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 21 327 2.0E-28
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 35 278 2.0E-28
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 35 342 2.0E-28
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 29 289 2.0E-28
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 32 323 2.0E-28
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 32 323 2.0E-28
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 32 323 2.0E-28
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 26 283 3.0E-28
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 27 341 3.0E-28
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 35 338 3.0E-28
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 21 327 3.0E-28
sp|Q54BF0|FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum GN=fhkA PE=3 SV=1 26 262 3.0E-28
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 26 283 3.0E-28
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 29 328 3.0E-28
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 32 354 3.0E-28
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 29 323 3.0E-28
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 26 283 3.0E-28
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 1 323 3.0E-28
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 26 283 3.0E-28
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 24 261 3.0E-28
sp|Q3UMW7|MAPK3_MOUSE MAP kinase-activated protein kinase 3 OS=Mus musculus GN=Mapkapk3 PE=1 SV=2 35 331 3.0E-28
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 29 262 3.0E-28
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 32 323 3.0E-28
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 23 364 4.0E-28
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 29 274 4.0E-28
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 32 346 4.0E-28
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 67 348 4.0E-28
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 32 346 4.0E-28
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 13 323 4.0E-28
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 29 289 4.0E-28
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 29 329 4.0E-28
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 21 327 5.0E-28
sp|Q2PQN9|CDK5_GLOMM Cyclin-dependent kinase 5 homolog OS=Glossina morsitans morsitans GN=Cdk5 PE=2 SV=1 26 274 5.0E-28
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 7 323 5.0E-28
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 23 329 5.0E-28
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 32 323 5.0E-28
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 21 327 5.0E-28
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 23 346 6.0E-28
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 29 284 6.0E-28
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 21 327 6.0E-28
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 29 329 6.0E-28
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 29 328 6.0E-28
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 29 274 6.0E-28
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 32 323 7.0E-28
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 29 284 7.0E-28
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 29 274 8.0E-28
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 26 283 9.0E-28
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 29 340 9.0E-28
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 29 337 9.0E-28
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 26 278 1.0E-27
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 35 341 1.0E-27
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 29 357 1.0E-27
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 29 329 1.0E-27
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 27 360 1.0E-27
sp|Q92241|PHO85_KLULA Negative regulator of the PHO system OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PHO85 PE=3 SV=2 35 313 1.0E-27
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 29 278 1.0E-27
sp|Q59S66|IPL1_CANAL Spindle assembly checkpoint kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPL1 PE=3 SV=1 35 346 1.0E-27
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 26 329 1.0E-27
sp|P23572|CDK1_DROME Cyclin-dependent kinase 1 OS=Drosophila melanogaster GN=Cdk1 PE=1 SV=1 35 289 1.0E-27
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 29 262 2.0E-27
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 6 326 2.0E-27
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 35 262 2.0E-27
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 29 340 2.0E-27
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 32 346 2.0E-27
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 26 326 2.0E-27
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 16 283 2.0E-27
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 35 278 2.0E-27
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 19 323 2.0E-27
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 4 283 2.0E-27
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 29 262 2.0E-27
sp|Q66H84|MAPK3_RAT MAP kinase-activated protein kinase 3 OS=Rattus norvegicus GN=Mapkapk3 PE=2 SV=1 35 331 2.0E-27
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 28 337 2.0E-27
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 29 274 2.0E-27
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 29 265 2.0E-27
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 29 262 2.0E-27
sp|P49137|MAPK2_HUMAN MAP kinase-activated protein kinase 2 OS=Homo sapiens GN=MAPKAPK2 PE=1 SV=1 87 338 3.0E-27
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 29 326 3.0E-27
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 32 283 3.0E-27
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 18 277 3.0E-27
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 35 262 3.0E-27
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 29 323 3.0E-27
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 29 323 3.0E-27
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 29 323 3.0E-27
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 29 323 3.0E-27
sp|Q9LZW4|CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14 OS=Arabidopsis thaliana GN=CIPK14 PE=1 SV=1 23 274 3.0E-27
sp|P49139|MAPK2_RABIT MAP kinase-activated protein kinase 2 (Fragment) OS=Oryctolagus cuniculus GN=MAPKAPK2 PE=1 SV=2 87 338 3.0E-27
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 29 262 3.0E-27
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 7 331 3.0E-27
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 29 274 3.0E-27
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 19 369 4.0E-27
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 29 262 4.0E-27
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 29 262 4.0E-27
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 35 283 4.0E-27
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 29 262 4.0E-27
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 35 268 4.0E-27
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 29 262 4.0E-27
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 29 262 4.0E-27
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 35 262 4.0E-27
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 9 274 4.0E-27
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 29 283 4.0E-27
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 23 330 4.0E-27
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 23 330 4.0E-27
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 29 274 4.0E-27
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 26 344 4.0E-27
sp|Q6SA08|TSSK4_HUMAN Testis-specific serine/threonine-protein kinase 4 OS=Homo sapiens GN=TSSK4 PE=1 SV=1 13 343 4.0E-27
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 35 394 5.0E-27
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 26 344 5.0E-27
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 9 343 5.0E-27
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 29 262 5.0E-27
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 35 338 5.0E-27
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 35 274 5.0E-27
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 29 262 5.0E-27
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 23 274 5.0E-27
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 29 289 6.0E-27
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 23 337 6.0E-27
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 35 274 7.0E-27
sp|P17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 35 274 7.0E-27
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 29 340 8.0E-27
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 29 265 8.0E-27
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 29 274 8.0E-27
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 35 268 8.0E-27
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 26 283 9.0E-27
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 22 353 9.0E-27
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 27 326 9.0E-27
sp|P49136|MAPK2_CRILO MAP kinase-activated protein kinase 2 (Fragment) OS=Cricetulus longicaudatus GN=MAPKAPK2 PE=2 SV=1 91 338 1.0E-26
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 26 278 1.0E-26
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 29 265 1.0E-26
sp|Q9LYQ8|CIPK2_ARATH CBL-interacting serine/threonine-protein kinase 2 OS=Arabidopsis thaliana GN=CIPK2 PE=1 SV=1 35 277 1.0E-26
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 35 262 1.0E-26
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 29 340 1.0E-26
sp|P38622|RCK1_YEAST Serine/threonine-protein kinase RCK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCK1 PE=3 SV=1 14 331 1.0E-26
sp|P49138|MAPK2_MOUSE MAP kinase-activated protein kinase 2 OS=Mus musculus GN=Mapkapk2 PE=1 SV=2 87 338 1.0E-26
sp|O94547|SRK1_SCHPO Serine/threonine-protein kinase srk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srk1 PE=1 SV=1 16 274 1.0E-26
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 35 315 1.0E-26
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 29 343 1.0E-26
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 35 323 1.0E-26
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 29 289 1.0E-26
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 29 262 1.0E-26
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 29 270 1.0E-26
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 4 341 1.0E-26
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 29 274 1.0E-26
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 12 328 1.0E-26
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 29 274 1.0E-26
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 32 344 1.0E-26
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 29 331 2.0E-26
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 25 330 2.0E-26
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 35 278 2.0E-26
sp|Q16644|MAPK3_HUMAN MAP kinase-activated protein kinase 3 OS=Homo sapiens GN=MAPKAPK3 PE=1 SV=1 35 331 2.0E-26
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 26 276 2.0E-26
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 13 323 2.0E-26
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 29 323 2.0E-26
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 29 328 2.0E-26
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 29 328 2.0E-26
sp|A8XWC4|DKF1_CAEBR Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis briggsae GN=dkf-1 PE=3 SV=2 29 348 2.0E-26
sp|Q3UTQ8|CDKL5_MOUSE Cyclin-dependent kinase-like 5 OS=Mus musculus GN=Cdkl5 PE=1 SV=1 26 331 2.0E-26
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 35 274 2.0E-26
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 24 283 3.0E-26
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 29 262 3.0E-26
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 29 328 3.0E-26
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 29 328 3.0E-26
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 29 262 3.0E-26
sp|O76039|CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens GN=CDKL5 PE=1 SV=1 29 331 3.0E-26
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 29 328 3.0E-26
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 29 262 3.0E-26
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 29 289 3.0E-26
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 29 274 3.0E-26
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 29 328 3.0E-26
sp|Q9XUJ7|DKF1_CAEEL Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis elegans GN=dkf-1 PE=1 SV=1 29 348 4.0E-26
sp|Q9BXA7|TSSK1_HUMAN Testis-specific serine/threonine-protein kinase 1 OS=Homo sapiens GN=TSSK1B PE=1 SV=1 21 283 4.0E-26
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 29 274 4.0E-26
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 29 274 4.0E-26
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 35 284 4.0E-26
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 12 323 4.0E-26
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 29 323 5.0E-26
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 31 326 5.0E-26
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 29 278 5.0E-26
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 31 326 5.0E-26
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 29 274 5.0E-26
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 29 274 5.0E-26
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 29 274 5.0E-26
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 26 278 5.0E-26
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 29 262 5.0E-26
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 4 276 5.0E-26
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 29 330 6.0E-26
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 35 277 6.0E-26
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 35 323 7.0E-26
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 16 262 8.0E-26
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 16 262 8.0E-26
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 20 262 8.0E-26
sp|Q15139|KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens GN=PRKD1 PE=1 SV=2 35 328 8.0E-26
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 12 273 8.0E-26
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 67 330 9.0E-26
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 29 385 9.0E-26
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 35 274 9.0E-26
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 26 278 9.0E-26
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 12 278 1.0E-25
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 35 279 1.0E-25
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 26 289 1.0E-25
sp|Q9WTQ1|KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus GN=Prkd1 PE=1 SV=2 35 328 1.0E-25
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 35 323 1.0E-25
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 35 274 1.0E-25
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 29 278 1.0E-25
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 13 415 1.0E-25
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 35 330 1.0E-25
sp|Q04899|CDK18_MOUSE Cyclin-dependent kinase 18 OS=Mus musculus GN=Cdk18 PE=1 SV=1 2 262 1.0E-25
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 35 261 1.0E-25
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus GN=Map3k1 PE=1 SV=3 35 279 1.0E-25
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 23 274 1.0E-25
sp|O14920|IKKB_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Homo sapiens GN=IKBKB PE=1 SV=1 6 265 1.0E-25
sp|Q62101|KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus GN=Prkd1 PE=1 SV=2 35 328 1.0E-25
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 22 280 1.0E-25
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 35 323 1.0E-25
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 2 268 1.0E-25
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 35 331 1.0E-25
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 26 290 1.0E-25
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 32 325 1.0E-25
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 29 262 1.0E-25
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 35 261 1.0E-25
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 26 274 2.0E-25
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 29 336 2.0E-25
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 35 261 2.0E-25
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 29 278 2.0E-25
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 29 278 2.0E-25
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 32 325 2.0E-25
sp|Q54QD5|NEK1_DICDI Probable serine/threonine-protein kinase nek1 OS=Dictyostelium discoideum GN=nek1 PE=3 SV=1 29 325 2.0E-25
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 16 262 2.0E-25
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 29 262 2.0E-25
sp|Q9BZL6|KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens GN=PRKD2 PE=1 SV=2 35 268 2.0E-25
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 35 323 2.0E-25
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 35 261 2.0E-25
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 27 286 2.0E-25
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 29 262 2.0E-25
sp|Q8BZ03|KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus GN=Prkd2 PE=1 SV=1 35 268 2.0E-25
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 35 261 2.0E-25
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 26 289 2.0E-25
sp|P39951|CDK1_RAT Cyclin-dependent kinase 1 OS=Rattus norvegicus GN=Cdk1 PE=1 SV=1 26 289 2.0E-25
sp|Q5XIS9|KPCD2_RAT Serine/threonine-protein kinase D2 OS=Rattus norvegicus GN=Prkd2 PE=1 SV=1 35 268 2.0E-25
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 26 290 2.0E-25
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 32 325 2.0E-25
sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens GN=PRKD3 PE=1 SV=1 29 268 2.0E-25
sp|Q75CH3|ATG1_ASHGO Serine/threonine-protein kinase ATG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG1 PE=3 SV=1 543 869 1.0E-10
sp|Q6BS08|ATG1_DEBHA Serine/threonine-protein kinase ATG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG1 PE=3 SV=2 468 869 5.0E-10
sp|P0CP71|ATG1_CRYNB Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG1 PE=3 SV=1 485 869 6.0E-09
sp|P0CP70|ATG1_CRYNJ Serine/threonine-protein kinase ATG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG1 PE=3 SV=1 485 869 1.0E-08
sp|Q6CSX2|ATG1_KLULA Serine/threonine-protein kinase ATG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG1 PE=3 SV=1 756 870 5.0E-08
sp|Q5A649|ATG1_CANAL Serine/threonine-protein kinase ATG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG1 PE=3 SV=1 477 862 1.0E-07
sp|Q6C7U0|ATG1_YARLI Serine/threonine-protein kinase ATG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG1 PE=3 SV=1 747 868 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004674 protein serine/threonine kinase activity Yes
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0006793 phosphorus metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0019538 protein metabolic process No
GO:0016301 kinase activity No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0032559 adenyl ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0036094 small molecule binding No
GO:0016310 phosphorylation No
GO:0000166 nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0032553 ribonucleotide binding No
GO:0044238 primary metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|114680
MNPATSPSVTASAAASSKRFAGAQELRPYVIVGDIGKGSFATVYKGYHEETHQQVAVKTVVTDKLSSKLFENLQS
EIQILKSLSHRHITRLIDIIRAEKNVYLIMEFCAGGDLTNYIKKRGRVDGLQYVPSPGAPPQYYPHPLTGGLDEV
VVRSFLRQLARALKFLRHRNLIHRDIKPQNLLLNPALPGELARGHPLGVPILKVADFGFARSLPNAMMAETLCGS
PLYMAPEILRYEKYDAKADLWSVGAVLYEMAVGKPPFRANNHIELLKKIEHAKSIKFPDEDISPRKHPAHTGKEE
PLVVPEDIKQLIRTLLKRQPAERSSFDEFFNSNALAKSKFPRPKDMEILSLQDSAVGEGETMNDSRGWPGRPPTP
EHHKIIPPEVLDPKAMIPPSRFNFRRPSVGSPLSPREPPQPGVDGSPKDGSLKATNDALPKINTSKERGTLDVGK
TAFPTMDNNRRRRMLTTDESFIPGETEEDGVLRREYVLVDDTRAVEFNRAVDELSARPRRPLHDRRMPPTPSTEE
YPPDGSSNPPSATSNATNNITFPPAPNTTLTAPPLSSSPSSLASRAASNALHRALNLASKKLFGTSRQSTHSHSH
SHSYTNSQSSATSSPRKPIIALDSDGATIGRGGPNGERDPMEDELLANLEELAQKTDVLTNWGDEMYEYVKAIPQ
KPLPDPTKFTKREGEPEKHARKRKHADMEAEYNAVTCVAVYMLLMSFSQKGINMLKQFQEHMGMKYPEGDYVVSE
GFDDALNWFKEHFMKCNERAALVKTWLPAQYDGPKAWLDQLVYDRALVLSRTAARKELLDQASAPDECEKLYEES
LWCLYALQDDLLQTGNPFMEEDRETIATWIKRTKLRLVRCRARMVMNDRDRLNDARADSNLADVARIPAPWDVKP
PTGDDVANGNQVLQVINTSS*
Coding >AgabiH97|114680
ATGAACCCGGCGACCTCGCCCTCGGTCACAGCGTCGGCCGCTGCGTCCTCTAAGAGGTTTGCTGGCGCCCAAGAA
CTACGCCCCTATGTCATTGTCGGCGACATCGGCAAGGGCAGCTTTGCCACCGTCTACAAGGGGTACCACGAGGAA
ACTCACCAGCAGGTTGCCGTCAAGACTGTTGTCACCGATAAGCTGTCCTCAAAGCTCTTTGAGAACCTGCAGAGC
GAAATCCAGATCCTCAAGTCTCTATCTCACCGGCATATAACTCGTCTCATTGACATTATACGTGCGGAGAAGAAC
GTGTATCTTATCATGGAGTTCTGTGCAGGCGGTGACTTGACCAACTATATCAAGAAACGTGGACGCGTCGATGGC
TTGCAATACGTTCCGTCCCCTGGCGCTCCCCCTCAGTATTATCCCCACCCTTTAACTGGAGGACTCGACGAGGTA
GTCGTGCGGAGCTTCCTACGTCAGCTAGCACGCGCACTCAAGTTTCTACGACATAGGAACCTTATACATCGGGAC
ATCAAGCCCCAGAACCTCCTCCTAAACCCTGCATTACCCGGAGAACTTGCACGCGGTCACCCACTCGGTGTGCCC
ATCCTCAAAGTCGCTGATTTTGGCTTTGCACGATCATTACCGAATGCTATGATGGCCGAAACATTATGTGGATCT
CCATTGTATATGGCGCCTGAAATTTTGCGATATGAGAAGTATGACGCGAAAGCCGACTTGTGGTCTGTCGGTGCG
GTGTTGTACGAGATGGCTGTTGGAAAGCCTCCCTTTCGAGCCAATAACCATATCGAATTACTCAAGAAGATCGAA
CACGCTAAGAGCATCAAATTTCCAGACGAAGACATCTCACCACGTAAACATCCAGCTCACACGGGGAAAGAAGAA
CCTTTGGTTGTTCCAGAGGATATCAAGCAACTCATACGGACATTACTCAAACGCCAACCTGCAGAACGCTCGAGT
TTCGATGAATTCTTCAATAGCAACGCTCTAGCAAAGAGCAAGTTTCCTCGCCCCAAGGATATGGAGATCTTGTCA
CTACAAGACTCTGCGGTGGGCGAAGGAGAAACCATGAATGATTCGAGAGGTTGGCCTGGTCGTCCACCAACACCG
GAGCACCATAAGATCATCCCACCTGAGGTGTTAGATCCCAAAGCTATGATCCCTCCCAGTCGATTCAACTTCCGC
AGACCTTCAGTAGGTTCTCCACTTTCCCCCAGAGAGCCACCGCAGCCAGGTGTAGATGGGAGTCCGAAAGATGGA
AGTCTGAAAGCTACAAATGACGCCCTGCCTAAAATCAACACGAGCAAAGAGCGAGGAACGCTGGATGTTGGTAAG
ACGGCATTTCCGACTATGGATAACAATCGAAGGCGGAGGATGCTTACGACGGACGAGTCGTTCATTCCTGGAGAG
ACGGAAGAGGATGGAGTTTTGAGGAGAGAATATGTCCTTGTGGACGATACAAGAGCGGTTGAGTTTAATCGCGCC
GTCGATGAATTGTCAGCGCGTCCACGAAGGCCATTGCATGATCGTCGTATGCCTCCGACACCTTCCACGGAAGAA
TACCCTCCAGATGGGAGTAGTAACCCCCCATCTGCAACGAGCAACGCAACAAATAATATAACTTTTCCACCAGCA
CCTAATACCACGCTAACCGCACCACCACTCTCTTCATCACCCTCTAGTCTTGCATCCCGTGCAGCTTCCAATGCT
CTTCACCGAGCACTTAATCTCGCTTCAAAGAAACTTTTTGGTACATCCCGTCAAAGTACTCACTCACATTCGCAT
TCGCATTCGTACACGAATTCACAGTCAAGTGCGACTTCTTCCCCTCGGAAGCCTATAATTGCACTTGATTCGGAT
GGGGCAACGATTGGCCGAGGAGGGCCTAATGGAGAAAGAGATCCTATGGAAGATGAACTATTGGCGAATTTGGAA
GAGTTGGCTCAGAAAACGGATGTGTTGACGAATTGGGGAGATGAGATGTACGAGTATGTGAAAGCTATACCACAA
AAACCATTGCCTGATCCGACGAAATTTACGAAACGAGAAGGTGAACCGGAGAAACACGCGAGAAAACGGAAACAT
GCGGATATGGAAGCTGAATATAATGCTGTGACATGCGTAGCGGTCTATATGCTACTCATGTCGTTTTCTCAGAAG
GGTATCAATATGTTGAAACAATTCCAAGAACATATGGGAATGAAGTACCCTGAGGGTGATTATGTCGTTAGCGAG
GGATTCGATGATGCTCTGAATTGGTTCAAGGAGCATTTCATGAAATGCAATGAACGTGCGGCTTTGGTCAAGACA
TGGTTACCGGCACAGTACGATGGTCCCAAAGCATGGTTAGACCAGTTGGTCTATGATCGTGCTCTCGTACTCTCG
AGAACAGCAGCACGGAAAGAGCTGTTAGATCAAGCATCAGCTCCAGATGAATGCGAGAAACTTTACGAAGAGAGC
CTATGGTGTCTGTACGCACTTCAAGACGATCTATTACAAACTGGTAATCCATTTATGGAAGAAGATCGGGAAACC
ATCGCGACCTGGATCAAGCGTACGAAGCTGAGACTGGTGAGATGTCGGGCGAGGATGGTCATGAATGATCGTGAT
AGGTTGAATGATGCTCGTGCGGATTCGAACCTGGCGGATGTAGCGAGGATTCCAGCTCCTTGGGATGTAAAGCCG
CCGACTGGTGATGATGTTGCGAATGGAAACCAGGTGCTGCAGGTCATCAACACGTCTTCATGA
Transcript >AgabiH97|114680
ATGAACCCGGCGACCTCGCCCTCGGTCACAGCGTCGGCCGCTGCGTCCTCTAAGAGGTTTGCTGGCGCCCAAGAA
CTACGCCCCTATGTCATTGTCGGCGACATCGGCAAGGGCAGCTTTGCCACCGTCTACAAGGGGTACCACGAGGAA
ACTCACCAGCAGGTTGCCGTCAAGACTGTTGTCACCGATAAGCTGTCCTCAAAGCTCTTTGAGAACCTGCAGAGC
GAAATCCAGATCCTCAAGTCTCTATCTCACCGGCATATAACTCGTCTCATTGACATTATACGTGCGGAGAAGAAC
GTGTATCTTATCATGGAGTTCTGTGCAGGCGGTGACTTGACCAACTATATCAAGAAACGTGGACGCGTCGATGGC
TTGCAATACGTTCCGTCCCCTGGCGCTCCCCCTCAGTATTATCCCCACCCTTTAACTGGAGGACTCGACGAGGTA
GTCGTGCGGAGCTTCCTACGTCAGCTAGCACGCGCACTCAAGTTTCTACGACATAGGAACCTTATACATCGGGAC
ATCAAGCCCCAGAACCTCCTCCTAAACCCTGCATTACCCGGAGAACTTGCACGCGGTCACCCACTCGGTGTGCCC
ATCCTCAAAGTCGCTGATTTTGGCTTTGCACGATCATTACCGAATGCTATGATGGCCGAAACATTATGTGGATCT
CCATTGTATATGGCGCCTGAAATTTTGCGATATGAGAAGTATGACGCGAAAGCCGACTTGTGGTCTGTCGGTGCG
GTGTTGTACGAGATGGCTGTTGGAAAGCCTCCCTTTCGAGCCAATAACCATATCGAATTACTCAAGAAGATCGAA
CACGCTAAGAGCATCAAATTTCCAGACGAAGACATCTCACCACGTAAACATCCAGCTCACACGGGGAAAGAAGAA
CCTTTGGTTGTTCCAGAGGATATCAAGCAACTCATACGGACATTACTCAAACGCCAACCTGCAGAACGCTCGAGT
TTCGATGAATTCTTCAATAGCAACGCTCTAGCAAAGAGCAAGTTTCCTCGCCCCAAGGATATGGAGATCTTGTCA
CTACAAGACTCTGCGGTGGGCGAAGGAGAAACCATGAATGATTCGAGAGGTTGGCCTGGTCGTCCACCAACACCG
GAGCACCATAAGATCATCCCACCTGAGGTGTTAGATCCCAAAGCTATGATCCCTCCCAGTCGATTCAACTTCCGC
AGACCTTCAGTAGGTTCTCCACTTTCCCCCAGAGAGCCACCGCAGCCAGGTGTAGATGGGAGTCCGAAAGATGGA
AGTCTGAAAGCTACAAATGACGCCCTGCCTAAAATCAACACGAGCAAAGAGCGAGGAACGCTGGATGTTGGTAAG
ACGGCATTTCCGACTATGGATAACAATCGAAGGCGGAGGATGCTTACGACGGACGAGTCGTTCATTCCTGGAGAG
ACGGAAGAGGATGGAGTTTTGAGGAGAGAATATGTCCTTGTGGACGATACAAGAGCGGTTGAGTTTAATCGCGCC
GTCGATGAATTGTCAGCGCGTCCACGAAGGCCATTGCATGATCGTCGTATGCCTCCGACACCTTCCACGGAAGAA
TACCCTCCAGATGGGAGTAGTAACCCCCCATCTGCAACGAGCAACGCAACAAATAATATAACTTTTCCACCAGCA
CCTAATACCACGCTAACCGCACCACCACTCTCTTCATCACCCTCTAGTCTTGCATCCCGTGCAGCTTCCAATGCT
CTTCACCGAGCACTTAATCTCGCTTCAAAGAAACTTTTTGGTACATCCCGTCAAAGTACTCACTCACATTCGCAT
TCGCATTCGTACACGAATTCACAGTCAAGTGCGACTTCTTCCCCTCGGAAGCCTATAATTGCACTTGATTCGGAT
GGGGCAACGATTGGCCGAGGAGGGCCTAATGGAGAAAGAGATCCTATGGAAGATGAACTATTGGCGAATTTGGAA
GAGTTGGCTCAGAAAACGGATGTGTTGACGAATTGGGGAGATGAGATGTACGAGTATGTGAAAGCTATACCACAA
AAACCATTGCCTGATCCGACGAAATTTACGAAACGAGAAGGTGAACCGGAGAAACACGCGAGAAAACGGAAACAT
GCGGATATGGAAGCTGAATATAATGCTGTGACATGCGTAGCGGTCTATATGCTACTCATGTCGTTTTCTCAGAAG
GGTATCAATATGTTGAAACAATTCCAAGAACATATGGGAATGAAGTACCCTGAGGGTGATTATGTCGTTAGCGAG
GGATTCGATGATGCTCTGAATTGGTTCAAGGAGCATTTCATGAAATGCAATGAACGTGCGGCTTTGGTCAAGACA
TGGTTACCGGCACAGTACGATGGTCCCAAAGCATGGTTAGACCAGTTGGTCTATGATCGTGCTCTCGTACTCTCG
AGAACAGCAGCACGGAAAGAGCTGTTAGATCAAGCATCAGCTCCAGATGAATGCGAGAAACTTTACGAAGAGAGC
CTATGGTGTCTGTACGCACTTCAAGACGATCTATTACAAACTGGTAATCCATTTATGGAAGAAGATCGGGAAACC
ATCGCGACCTGGATCAAGCGTACGAAGCTGAGACTGGTGAGATGTCGGGCGAGGATGGTCATGAATGATCGTGAT
AGGTTGAATGATGCTCGTGCGGATTCGAACCTGGCGGATGTAGCGAGGATTCCAGCTCCTTGGGATGTAAAGCCG
CCGACTGGTGATGATGTTGCGAATGGAAACCAGGTGCTGCAGGTCATCAACACGTCTTCATGA
Gene >AgabiH97|114680
ATGAACCCGGCGACCTCGCCCTCGGTCACAGCGTCGGCCGCTGCGTCCTCTAAGAGGTTTGCTGGCGCCCAAGAA
CTACGCCCCTATGTCATTGTCGGCGACATCGGCAAGGGCAGCTTTGCCACCGTCTACAAGGGGTACCACGAGGTG
ACTCCCATTCCGCCCTTCCCCGTCTCACTTTTGACGTTGTGCGCCACAGGAAACTCACCAGCAGGTTGCCGTCAA
GACTGTTGTCACCGATAAGCTGTCCTCAAAGCTCTTTGAGAACCTGCAGAGCGAAATCCAGATCCTCAAGTCTCT
ATCTCACCGGCATATAACTCGTCTCATTGACATTATAGTGAGTAATTCTTGTCTCTTTTCCTCATACCACCCAAT
AGTTGTTGAGCTTGCTCCAATCACCTCTAGCGTGCGGAGAAGAACGTGTATCTTATCATGGAGTTCTGTGCAGGC
GGTGACTTGACCAACTATATCAAGAAACGTGGACGCGTCGATGGCTTGCAATACGTTCCGTCCCCTGGCGCTCCC
CCTCAGTATTATCCCCACCCTTTAACTGGAGGACTCGACGAGGTAGTCGTGCGGAGCTTCCTACGTCAGCTAGGT
AAGTACTGATGTCTTCTTTTGGGCATATCTCCATGTCTGATTCATCCGAACAGCACGCGCACTCAAGTTTCTACG
ACATAGGAACCTTATACATCGGGACATCAAGCCCCAGAACCTCCTCCTAAACCCTGCATTACCCGGAGAACTTGC
ACGCGGTCACCCACTCGGTGTGCCCATCCTCAAAGTCGCTGATTTTGGCTTTGCACGATCATTACCGAATGCTAT
GATGGCCGAAACATTATGTGGATCTCCGTACGTCGCTCAATACTGCAATTGCAATGTTGCTCATATCTTTTGTCA
CACGATACAGATTGTATATGGCGCCTGAAATTTTGCGATATGAGAAGTATGACGCGAAAGCCGACTTGTGGTCTG
TCGGTGCGGTGTTGTACGAGATGGCTGTTGGAAAGCCTCCCTTTCGAGCCAATAACCATATCGAATTACTCAAGA
AGATCGAACACGCTAAGAGCATCAAATTTCCAGACGAAGACATCTCACCACGTAAACATCCAGCTCACACGGGGA
AAGAAGAACCTTTGGTTGTTCCAGAGGATATCAAGCAACTCATACGGACATTACTCAAACGCCAACCTGCAGAAC
GCTCGAGTTTCGATGAATTCTTCAATAGCAACGCTCTAGCAAAGAGCAAGTTTCCTCGCCCCAAGGATATGGAGA
TCTTGTCACTACAAGACTCTGCGGTGGGCGAAGGAGAAACCATGAATGATTCGAGAGGTTGGCCTGGTCGTCCAC
CAACACCGGAGCACCATAAGATCATCCCACCTGAGGTGTTAGATCCCAAAGCTATGATCCCTCCCAGTCGATTCA
ACTTCCGCAGACCTTCAGTAGGTTCTCCACTTTCCCCCAGAGAGCCACCGCAGCCAGGTGTAGATGGGAGTCCGA
AAGATGGAAGTCTGAAAGCTACAAATGACGCCCTGCCTAAAATCAACACGAGCAAAGAGCGAGGAACGCTGGATG
TTGGTAAGACGGCATTTCCGACTATGGATAACAATCGAAGGCGGAGGATGCTTACGACGGACGAGTCGTTCATTC
CTGGAGAGACGGAAGAGGATGGAGTTTTGAGGAGAGAATATGTCCTTGTGGACGATACAAGAGCGGTTGAGTTTA
ATCGCGCCGTCGATGGTGAGTATCTTCGCTCTCTCCTTTCGCTGTCGTTTTAATAGTTTGCTGTAGAATTGTCAG
CGCGTCCACGAAGGCCATTGCATGATCGTCGTATGCCTCCGACACCTTCCACGGAAGAATACCCTCCAGATGGGA
GTAGTAACCCCCCATCTGCAACGAGCAACGCAACAAATAATATAACTTTTCCACCAGCACCTAATACCACGCTAA
CCGCACCACCACTCTCTTCATCACCCTCTAGTCTTGCATCCCGTGCAGCTTCCAATGCTCTTCACCGAGCACTTA
ATCTCGCTTCAAAGAAACTTTTTGGTACATCCCGTCAAAGTACTCACTCACATTCGCATTCGCATTCGTACACGA
ATTCACAGTCAAGTGCGACTTCTTCCCCTCGGAAGCCTATAATTGCACTTGATTCGGATGGGGCAACGATTGGCC
GAGGAGGGCCTAATGGAGAAAGAGATCCTATGGAAGATGAACTATTGGCGAATTTGGAAGAGTTGGCTCAGAAAA
CGGATGTGTTGACGAATTGGGGAGATGAGATGTACGAGTATGTGAAAGCTATACCACAAAGTGAGTTACAATTTC
CATTTGTCTCTTCAACACGATTTTTTGCTTTACTTTGGCGTTAGCGTTGCGAAATTGGCGTCTTGCTGACATCTT
TGTTAGAACCATTGCCTGATCCGACGAAATTTACGAAACGAGAAGGTGAACCGGAGAAACACGCGAGAAAACGGA
AACATGCGGATATGGAAGCTGAATATAATGCTGTGACATGCGTAGCGGTCTATATGCTACTCATGTCGTTTTCTC
AGAAGGGTATCAATATGTTGAAACAATTCCAAGAACATATGGGAATGAAGTACCCTGAGGGTGATTATGTCGTTA
GCGAGGGATTCGATGATGGTAAGTTACTTCCAAAACTGTCTAGGGGCACTGGCGCTTACTTTAGTAGCTCTGAAT
TGGTTCAAGGAGCATTTCATGAAATGCAATGAACGTGCGGCTTTGGTCAAGACATGGTTACCGGCACAGTACGAT
GGTCCCAAAGCATGGTTAGACCAGTTGGTCTATGATCGTGCTCTCGTACTCGTATGTATTGGAGCCTTTTTCGTT
ATCTGCCAGACGCGCTCAAAATTGTTTGTAGTCGAGAACAGCAGCACGGAAAGAGCTGTTAGATCAAGCATCAGC
TCCAGATGAATGCGAGAAACTTTACGAAGAGAGCCTATGGTGTCTGTACGCACTTCAAGACGATCTATTACAAAC
TGGTAATCCATTTATGGAAGAAGATCGGGAAACCATCGCGACCTGTATGTTTATTTTCATTTCCTTTCCCACATT
TGACATTCATCTTGCATATTACGTGTCAGGGATCAAGCGTACGAAGCTGAGACTGGTGAGATGTCGGGCGAGGAT
GGTCATGAATGATCGTGATAGGTTGAATGATGCTCGTGCGGATTCGAACCTGGCGGATGTAGCGAGGATTCCAGC
TCCTTGGGATGTAAAGCCGCCGACTGGTGATGATGTTGCGAATGGAAACCAGGTGCTGCAGGTCATCAACACGTC
TTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail