Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|114570
Gene name
Locationscaffold_9:259859..261818
Strand+
Gene length (bp)1959
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05426 Alginate_lyase Alginate lyase 3.4E-61 73 363

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016829 lyase activity Yes
GO:0042597 periplasmic space Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 48.11 22.81 73.41
Initials Initials knots 12.92 6.65 19.18
Pileal_Stipeal_center Stage I stipe center 16.00 8.25 23.74
Pileal_Stipeal_shell Stage I stipe shell 52.49 30.29 74.69
DIF_stipe_center Stage II stipe center 3.27 1.37 5.17
DIF_stipe_shell Stage II stipe shell 2.75 1.09 4.40
DIF_stipe_skin Stage II stipe skin 16.50 8.53 24.47
DIF_cap_skin Stage II cap skin 39.98 23.26 56.70
DIF_cap_tissue Stage II cap tissue 24.26 13.41 35.12
DIF_gill_tissue Stage II gill tissue 26.51 14.44 38.58
YFB_stipe_center Young fruiting body stipe center 7.62 3.13 12.12
YFB_stipe_shell Young fruiting body stipe shell 2.36 0.91 3.81
YFB_stipe_skin Young fruiting body stipe skin 10.90 5.38 16.43
YFB_cap_skin Young fruiting body cap skin 26.79 15.13 38.45
YFB_cap_tissue Young fruiting body cap tissue 2.51 1.00 4.03
YFB_gill_tissue Young fruiting body gill tissue 40.24 23.42 57.07
YFB_veil Young fruiting body veil 40.57 23.33 57.81

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.076803 no
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.078769 no
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.698319 no
Casing YFB_veil 0.723061 no
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.001625 yes
Casing Pileal_Stipeal_shell 0.878407 no
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.001140 yes
Casing DIF_cap_skin 0.686844 no
Casing DIF_cap_tissue 0.041603 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.003365 yes
DIF_gill_tissue YFB_cap_skin 0.985489 no
DIF_gill_tissue YFB_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_gill_tissue 0.187053 no
DIF_gill_tissue YFB_veil 0.186930 no
YFB_stipe_center YFB_stipe_shell 0.001140 yes
YFB_stipe_center YFB_stipe_skin 0.423173 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.003365 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.000613 yes
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.936308 no
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.002951 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.000613 yes
YFB_cap_skin YFB_gill_tissue 0.190735 no
YFB_cap_skin YFB_veil 0.191220 no
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.988311 no
Initials DIF_gill_tissue 0.020260 yes
Initials YFB_stipe_center 0.174631 no
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.741726 no
Initials YFB_cap_skin 0.015242 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.652873 no
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.589781 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.046536 yes
Pileal_Stipeal_center DIF_gill_tissue 0.134571 no
Pileal_Stipeal_center YFB_stipe_center 0.036455 yes
Pileal_Stipeal_center YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_center YFB_stipe_skin 0.328018 no
Pileal_Stipeal_center YFB_cap_skin 0.113810 no
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.002084 yes
Pileal_Stipeal_center YFB_veil 0.001625 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.000613 yes
Pileal_Stipeal_center DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_skin 0.962704 no
Pileal_Stipeal_center DIF_cap_skin 0.002525 yes
Pileal_Stipeal_center DIF_cap_tissue 0.244911 no
Pileal_Stipeal_shell DIF_gill_tissue 0.014956 yes
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.011968 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.452620 no
Pileal_Stipeal_shell YFB_veil 0.480337 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.440393 no
Pileal_Stipeal_shell DIF_cap_tissue 0.005671 yes
DIF_stipe_center DIF_gill_tissue 0.000613 yes
DIF_stipe_center YFB_stipe_center 0.025711 yes
DIF_stipe_center YFB_stipe_shell 0.536668 no
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.638304 no
DIF_stipe_center YFB_gill_tissue 0.000613 yes
DIF_stipe_center YFB_veil 0.000613 yes
DIF_stipe_center DIF_stipe_shell 0.783825 no
DIF_stipe_center DIF_stipe_skin 0.000613 yes
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.004928 yes
DIF_stipe_shell YFB_stipe_shell 0.827012 no
DIF_stipe_shell YFB_stipe_skin 0.000613 yes
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.909952 no
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.000613 yes
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.166446 no
DIF_stipe_skin YFB_stipe_center 0.028437 yes
DIF_stipe_skin YFB_stipe_shell 0.000613 yes
DIF_stipe_skin YFB_stipe_skin 0.276624 no
DIF_stipe_skin YFB_cap_skin 0.145518 no
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.002084 yes
DIF_stipe_skin YFB_veil 0.002525 yes
DIF_stipe_skin DIF_cap_skin 0.002951 yes
DIF_stipe_skin DIF_cap_tissue 0.288884 no
DIF_cap_skin DIF_gill_tissue 0.197111 no
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.198538 no
DIF_cap_skin YFB_cap_tissue 0.000613 yes
DIF_cap_skin YFB_gill_tissue 0.990471 no
DIF_cap_skin YFB_veil 0.979484 no
DIF_cap_skin DIF_cap_tissue 0.098108 no
DIF_cap_tissue DIF_gill_tissue 0.875171 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.009123 yes
DIF_cap_tissue YFB_cap_skin 0.850346 no
DIF_cap_tissue YFB_cap_tissue 0.000613 yes
DIF_cap_tissue YFB_gill_tissue 0.088095 no
DIF_cap_tissue YFB_veil 0.086416 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|114570
MASTTLLSRTVTLRSLALALLVSTGVVRAVTSYANDFADPDYIVSGNFGKNTQAAQNTIVEWAKDSAVGGPWSVT
SKPYTPPSGDKHDYMSWSPYWWPDCSEAGNKTELTPEQIWTTCPYKQRDGLFNPDVREINDIGHFESLADAVLYN
TLAWSISQDRTYADTAAKFIKTWFLDDATRMNPNLNYGQVKRGPGNSNGTHTGLLDLKCMTKVVNGILILRKTNS
SAWPGDMDSGMNTWVQQYIAWLETATIANEEQSAANNHGTFFYNQLASLKILLGDFAGARNVTDMYFNGIYMNQI
VEGGEQPLEAIRTRPYHYRAYNLAAMITNARLAQYADRNAPSMWNKTTEEGSTIKDALDYAMTISPSASHEDNYA
QELYLNVAAVASVYGDPDGKYATFLDQKEPQFVQEPFYLWNQPFAMKEGLAAAPNNTKPNNNASNPKNNNSAMSG
RSVNDIGLYTVILSYLVYLLT*
Coding >AgabiH97|114570
ATGGCCTCCACTACACTCCTTTCCCGAACTGTGACACTACGCTCCCTCGCTCTAGCTTTACTTGTTTCCACTGGC
GTCGTACGAGCTGTCACAAGCTATGCCAATGATTTCGCCGATCCGGACTATATCGTCAGCGGAAATTTTGGAAAG
AACACGCAAGCAGCGCAGAATACGATTGTTGAGTGGGCCAAAGATAGTGCGGTCGGTGGTCCTTGGTCGGTAACG
AGCAAGCCTTATACGCCACCGTCGGGCGATAAACATGATTACATGAGTTGGAGCCCTTATTGGTGGCCTGATTGT
TCTGAGGCAGGCAACAAGACTGAACTCACACCTGAGCAGATCTGGACAACATGCCCGTACAAACAACGTGATGGT
TTATTTAATCCGGACGTCCGTGAAATCAACGATATCGGACACTTCGAGTCGCTTGCCGATGCTGTTTTGTACAAT
ACCCTTGCTTGGAGTATATCACAGGACCGCACCTACGCGGACACCGCAGCCAAGTTCATCAAGACATGGTTTCTT
GATGATGCCACTCGCATGAACCCCAACCTTAATTATGGCCAGGTAAAGCGTGGCCCTGGAAATTCAAACGGCACA
CATACCGGTCTTTTGGACCTCAAATGTATGACCAAGGTTGTTAACGGTATCCTCATCTTGCGAAAGACCAATAGC
TCCGCATGGCCCGGCGACATGGATAGTGGAATGAACACCTGGGTCCAGCAATATATCGCGTGGCTCGAAACTGCT
ACAATTGCAAATGAAGAACAGTCGGCAGCCAATAATCACGGTACATTTTTCTATAATCAGCTCGCTTCTCTCAAA
ATTCTGCTTGGAGATTTTGCTGGCGCAAGAAATGTGACAGATATGTATTTCAATGGTATTTATATGAACCAGATC
GTCGAAGGAGGGGAACAGCCCTTGGAAGCCATACGAACTAGACCCTACCATTACCGAGCATACAATTTGGCCGCT
ATGATTACCAATGCACGCCTCGCCCAATATGCAGACCGCAATGCTCCGTCGATGTGGAATAAGACGACAGAAGAG
GGTTCTACCATCAAAGATGCGCTCGATTACGCAATGACGATTTCTCCTAGTGCCAGCCATGAAGATAATTACGCA
CAGGAGCTGTATCTCAACGTGGCTGCCGTTGCTTCTGTTTATGGGGACCCCGATGGAAAATATGCCACATTTTTG
GACCAGAAGGAGCCACAGTTTGTACAAGAGCCGTTTTATTTGTGGAACCAGCCGTTTGCTATGAAGGAGGGATTG
GCCGCTGCTCCTAATAATACTAAACCCAACAACAACGCTAGTAATCCGAAGAACAACAACAGTGCGATGTCTGGG
AGGAGTGTGAACGATATTGGACTATACACAGTTATTCTAAGCTATCTTGTTTATTTGTTGACCTAA
Transcript >AgabiH97|114570
ATGGCCTCCACTACACTCCTTTCCCGAACTGTGACACTACGCTCCCTCGCTCTAGCTTTACTTGTTTCCACTGGC
GTCGTACGAGCTGTCACAAGCTATGCCAATGATTTCGCCGATCCGGACTATATCGTCAGCGGAAATTTTGGAAAG
AACACGCAAGCAGCGCAGAATACGATTGTTGAGTGGGCCAAAGATAGTGCGGTCGGTGGTCCTTGGTCGGTAACG
AGCAAGCCTTATACGCCACCGTCGGGCGATAAACATGATTACATGAGTTGGAGCCCTTATTGGTGGCCTGATTGT
TCTGAGGCAGGCAACAAGACTGAACTCACACCTGAGCAGATCTGGACAACATGCCCGTACAAACAACGTGATGGT
TTATTTAATCCGGACGTCCGTGAAATCAACGATATCGGACACTTCGAGTCGCTTGCCGATGCTGTTTTGTACAAT
ACCCTTGCTTGGAGTATATCACAGGACCGCACCTACGCGGACACCGCAGCCAAGTTCATCAAGACATGGTTTCTT
GATGATGCCACTCGCATGAACCCCAACCTTAATTATGGCCAGGTAAAGCGTGGCCCTGGAAATTCAAACGGCACA
CATACCGGTCTTTTGGACCTCAAATGTATGACCAAGGTTGTTAACGGTATCCTCATCTTGCGAAAGACCAATAGC
TCCGCATGGCCCGGCGACATGGATAGTGGAATGAACACCTGGGTCCAGCAATATATCGCGTGGCTCGAAACTGCT
ACAATTGCAAATGAAGAACAGTCGGCAGCCAATAATCACGGTACATTTTTCTATAATCAGCTCGCTTCTCTCAAA
ATTCTGCTTGGAGATTTTGCTGGCGCAAGAAATGTGACAGATATGTATTTCAATGGTATTTATATGAACCAGATC
GTCGAAGGAGGGGAACAGCCCTTGGAAGCCATACGAACTAGACCCTACCATTACCGAGCATACAATTTGGCCGCT
ATGATTACCAATGCACGCCTCGCCCAATATGCAGACCGCAATGCTCCGTCGATGTGGAATAAGACGACAGAAGAG
GGTTCTACCATCAAAGATGCGCTCGATTACGCAATGACGATTTCTCCTAGTGCCAGCCATGAAGATAATTACGCA
CAGGAGCTGTATCTCAACGTGGCTGCCGTTGCTTCTGTTTATGGGGACCCCGATGGAAAATATGCCACATTTTTG
GACCAGAAGGAGCCACAGTTTGTACAAGAGCCGTTTTATTTGTGGAACCAGCCGTTTGCTATGAAGGAGGGATTG
GCCGCTGCTCCTAATAATACTAAACCCAACAACAACGCTAGTAATCCGAAGAACAACAACAGTGCGATGTCTGGG
AGGAGTGTGAACGATATTGGACTATACACAGTTATTCTAAGCTATCTTGTTTATTTGTTGACCTAA
Gene >AgabiH97|114570
ATGGCCTCCACTACACTCCTTTCCCGAACTGTGACACTACGCTCCCTCGCTCTAGCTTTACTTGTTTCCACTGGC
GTCGTACGAGCTGTCACAAGCTATGCCAATGATTTCGCCGATCCGGACTATATCGTCAGCGGAAATTTTGGAAAG
AACACGCAAGCAGCGCAGAATACGATTGTTGAGTGGGCCAAAGATAGTGCGGTCGGTGGTCCTTGGTGTACGTCC
CCAAAAATTTATTGTCAAGTTTCACTAGTCCTTAAGATTTCGGTTCTAAAGCGGTAACGAGCAAGCCTTATACGC
CACCGTCGGGCGATAAACATGATTACATGAGTTGGAGCCCTTAGTAAGTGGCTAGATTTTGGTGTGCGATGTTCT
CCTGGAGCTCAGAGTATATGCGGCTATTTGCAGTTGGTGGCCTGATTGTTCTGAGGCAGGCAACAAGACTGAACT
CACACCTGAGCAGAGTATGTTTGTGTTCAAACTTTTTTCGAAAGAGCAACTAATGAGTGACGCAACATGCGTAGT
CTGGACAACATGCCCGTACAAACAACGTGATGGTTTATTTAATCCGGACGTCCGTGAAATCAACGATATCGGACA
CTTCGAGTCGCTTGCCGATGCTGTTTTGTACAATACCCTTGCTTGGAGTATATCACAGGACCGCACCTACGCGGA
CACCGCAGGTGAGTCTGACACTTTGAGTTTGATGCGCAGCGTGGTGTGCTATTTTTGAGCGGCGGGAAGTCTAAT
AAGACACGGCTTCTCGTCGTCCGGTGCCTTGTTCCGTGTTTCCCGCAGTAATTATGGTTCTGAATCTTCCCATCC
GCAGCCAAGTTCATCAAGACATGGTTTCTTGATGATGCCACTCGCATGAACCCCAACCTTAATTATGGCCAGGTA
AAGCGTGGCCCTGGAAATTCAAACGGCACACATACCGGTCTTTTGTACGGGCCACTGACAATTTCCTCGTTGTGG
AGGAGTTTCTGATCATGCATGCAGGGACCTCAAATGTATGACCAAGGTTGTTAACGGTATCCTCATCTTGCGAAA
GACCAATAGCTCCGCATGGCCCGGCGACATGGATAGTGGAATGAACACCTGGGTCCAGCAATATATCGCGTGGCT
CGAAACTGCTACAATTGCAAATGAAGAACAGTCGGCAGCCAAGTAATTGATTATTATATACTCGATCCAGGCATA
ATGAACTGACGCTCGCCAGTAATCACGGTACATTTTTCTATAATCAGCTCGCTTCTCTCAAAATTCTGCTTGGAG
ATTTTGCTGGCGCAAGAAATGTGACAGATATGTATTTCAATGGTATTTATATGAACCAGATCGTCGAAGGAGGGG
AACAGGTGAATACGCACGTTCTTTAGGTCTTGAAATGTCTCATTCACGTCATTCCAGCCCTTGGAAGCCATACGA
ACTAGACCCTACCATTACCGAGCATACAATTTGGCCGCTATGATTGTATGTTTATATTTCCTTTATGTCGCCCCC
ATTTCCTGATGAATGGTGATATAGACCAATGCACGCCTCGCCCAATATGCAGACCGCAATGCTCCGTCGATGTGG
AATAAGACGACAGAAGAGGGTTCTACCATCAAAGATGCGCTCGATTACGCAATGACGATTTCTCCTAGTGCCAGC
CATGAAGATAATTACGCACAGGAGCTGTATCTCAACGTGGCTGCCGTTGCTTCTGTTTATGGGGACCCCGATGGA
AAATATGCCACATTTTTGGACCAGAAGGAGCCACAGTTTGTACAAGAGCCGTTTTATTTGTGGAACCAGCCGTTT
GCTATGAAGGAGGGATTGGCCGCTGCTCCTAATAATACTAAACCCAACAACAACGCTAGTAATCCGAAGAACAAC
AACAGTGCGATGTCTGGGAGGAGTGTGAACGATATTGGACTATACACAGTTATTCTAAGCTATCTTGTTTATTTG
TTGACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail