Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|114570
Gene name
Locationscaffold_9:259859..261818
Strand+
Gene length (bp)1959
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05426 Alginate_lyase Alginate lyase 3.4E-61 73 363

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016829 lyase activity Yes
GO:0042597 periplasmic space Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|114570
MASTTLLSRTVTLRSLALALLVSTGVVRAVTSYANDFADPDYIVSGNFGKNTQAAQNTIVEWAKDSAVGGPWSVT
SKPYTPPSGDKHDYMSWSPYWWPDCSEAGNKTELTPEQIWTTCPYKQRDGLFNPDVREINDIGHFESLADAVLYN
TLAWSISQDRTYADTAAKFIKTWFLDDATRMNPNLNYGQVKRGPGNSNGTHTGLLDLKCMTKVVNGILILRKTNS
SAWPGDMDSGMNTWVQQYIAWLETATIANEEQSAANNHGTFFYNQLASLKILLGDFAGARNVTDMYFNGIYMNQI
VEGGEQPLEAIRTRPYHYRAYNLAAMITNARLAQYADRNAPSMWNKTTEEGSTIKDALDYAMTISPSASHEDNYA
QELYLNVAAVASVYGDPDGKYATFLDQKEPQFVQEPFYLWNQPFAMKEGLAAAPNNTKPNNNASNPKNNNSAMSG
RSVNDIGLYTVILSYLVYLLT*
Coding >AgabiH97|114570
ATGGCCTCCACTACACTCCTTTCCCGAACTGTGACACTACGCTCCCTCGCTCTAGCTTTACTTGTTTCCACTGGC
GTCGTACGAGCTGTCACAAGCTATGCCAATGATTTCGCCGATCCGGACTATATCGTCAGCGGAAATTTTGGAAAG
AACACGCAAGCAGCGCAGAATACGATTGTTGAGTGGGCCAAAGATAGTGCGGTCGGTGGTCCTTGGTCGGTAACG
AGCAAGCCTTATACGCCACCGTCGGGCGATAAACATGATTACATGAGTTGGAGCCCTTATTGGTGGCCTGATTGT
TCTGAGGCAGGCAACAAGACTGAACTCACACCTGAGCAGATCTGGACAACATGCCCGTACAAACAACGTGATGGT
TTATTTAATCCGGACGTCCGTGAAATCAACGATATCGGACACTTCGAGTCGCTTGCCGATGCTGTTTTGTACAAT
ACCCTTGCTTGGAGTATATCACAGGACCGCACCTACGCGGACACCGCAGCCAAGTTCATCAAGACATGGTTTCTT
GATGATGCCACTCGCATGAACCCCAACCTTAATTATGGCCAGGTAAAGCGTGGCCCTGGAAATTCAAACGGCACA
CATACCGGTCTTTTGGACCTCAAATGTATGACCAAGGTTGTTAACGGTATCCTCATCTTGCGAAAGACCAATAGC
TCCGCATGGCCCGGCGACATGGATAGTGGAATGAACACCTGGGTCCAGCAATATATCGCGTGGCTCGAAACTGCT
ACAATTGCAAATGAAGAACAGTCGGCAGCCAATAATCACGGTACATTTTTCTATAATCAGCTCGCTTCTCTCAAA
ATTCTGCTTGGAGATTTTGCTGGCGCAAGAAATGTGACAGATATGTATTTCAATGGTATTTATATGAACCAGATC
GTCGAAGGAGGGGAACAGCCCTTGGAAGCCATACGAACTAGACCCTACCATTACCGAGCATACAATTTGGCCGCT
ATGATTACCAATGCACGCCTCGCCCAATATGCAGACCGCAATGCTCCGTCGATGTGGAATAAGACGACAGAAGAG
GGTTCTACCATCAAAGATGCGCTCGATTACGCAATGACGATTTCTCCTAGTGCCAGCCATGAAGATAATTACGCA
CAGGAGCTGTATCTCAACGTGGCTGCCGTTGCTTCTGTTTATGGGGACCCCGATGGAAAATATGCCACATTTTTG
GACCAGAAGGAGCCACAGTTTGTACAAGAGCCGTTTTATTTGTGGAACCAGCCGTTTGCTATGAAGGAGGGATTG
GCCGCTGCTCCTAATAATACTAAACCCAACAACAACGCTAGTAATCCGAAGAACAACAACAGTGCGATGTCTGGG
AGGAGTGTGAACGATATTGGACTATACACAGTTATTCTAAGCTATCTTGTTTATTTGTTGACCTAA
Transcript >AgabiH97|114570
ATGGCCTCCACTACACTCCTTTCCCGAACTGTGACACTACGCTCCCTCGCTCTAGCTTTACTTGTTTCCACTGGC
GTCGTACGAGCTGTCACAAGCTATGCCAATGATTTCGCCGATCCGGACTATATCGTCAGCGGAAATTTTGGAAAG
AACACGCAAGCAGCGCAGAATACGATTGTTGAGTGGGCCAAAGATAGTGCGGTCGGTGGTCCTTGGTCGGTAACG
AGCAAGCCTTATACGCCACCGTCGGGCGATAAACATGATTACATGAGTTGGAGCCCTTATTGGTGGCCTGATTGT
TCTGAGGCAGGCAACAAGACTGAACTCACACCTGAGCAGATCTGGACAACATGCCCGTACAAACAACGTGATGGT
TTATTTAATCCGGACGTCCGTGAAATCAACGATATCGGACACTTCGAGTCGCTTGCCGATGCTGTTTTGTACAAT
ACCCTTGCTTGGAGTATATCACAGGACCGCACCTACGCGGACACCGCAGCCAAGTTCATCAAGACATGGTTTCTT
GATGATGCCACTCGCATGAACCCCAACCTTAATTATGGCCAGGTAAAGCGTGGCCCTGGAAATTCAAACGGCACA
CATACCGGTCTTTTGGACCTCAAATGTATGACCAAGGTTGTTAACGGTATCCTCATCTTGCGAAAGACCAATAGC
TCCGCATGGCCCGGCGACATGGATAGTGGAATGAACACCTGGGTCCAGCAATATATCGCGTGGCTCGAAACTGCT
ACAATTGCAAATGAAGAACAGTCGGCAGCCAATAATCACGGTACATTTTTCTATAATCAGCTCGCTTCTCTCAAA
ATTCTGCTTGGAGATTTTGCTGGCGCAAGAAATGTGACAGATATGTATTTCAATGGTATTTATATGAACCAGATC
GTCGAAGGAGGGGAACAGCCCTTGGAAGCCATACGAACTAGACCCTACCATTACCGAGCATACAATTTGGCCGCT
ATGATTACCAATGCACGCCTCGCCCAATATGCAGACCGCAATGCTCCGTCGATGTGGAATAAGACGACAGAAGAG
GGTTCTACCATCAAAGATGCGCTCGATTACGCAATGACGATTTCTCCTAGTGCCAGCCATGAAGATAATTACGCA
CAGGAGCTGTATCTCAACGTGGCTGCCGTTGCTTCTGTTTATGGGGACCCCGATGGAAAATATGCCACATTTTTG
GACCAGAAGGAGCCACAGTTTGTACAAGAGCCGTTTTATTTGTGGAACCAGCCGTTTGCTATGAAGGAGGGATTG
GCCGCTGCTCCTAATAATACTAAACCCAACAACAACGCTAGTAATCCGAAGAACAACAACAGTGCGATGTCTGGG
AGGAGTGTGAACGATATTGGACTATACACAGTTATTCTAAGCTATCTTGTTTATTTGTTGACCTAA
Gene >AgabiH97|114570
ATGGCCTCCACTACACTCCTTTCCCGAACTGTGACACTACGCTCCCTCGCTCTAGCTTTACTTGTTTCCACTGGC
GTCGTACGAGCTGTCACAAGCTATGCCAATGATTTCGCCGATCCGGACTATATCGTCAGCGGAAATTTTGGAAAG
AACACGCAAGCAGCGCAGAATACGATTGTTGAGTGGGCCAAAGATAGTGCGGTCGGTGGTCCTTGGTGTACGTCC
CCAAAAATTTATTGTCAAGTTTCACTAGTCCTTAAGATTTCGGTTCTAAAGCGGTAACGAGCAAGCCTTATACGC
CACCGTCGGGCGATAAACATGATTACATGAGTTGGAGCCCTTAGTAAGTGGCTAGATTTTGGTGTGCGATGTTCT
CCTGGAGCTCAGAGTATATGCGGCTATTTGCAGTTGGTGGCCTGATTGTTCTGAGGCAGGCAACAAGACTGAACT
CACACCTGAGCAGAGTATGTTTGTGTTCAAACTTTTTTCGAAAGAGCAACTAATGAGTGACGCAACATGCGTAGT
CTGGACAACATGCCCGTACAAACAACGTGATGGTTTATTTAATCCGGACGTCCGTGAAATCAACGATATCGGACA
CTTCGAGTCGCTTGCCGATGCTGTTTTGTACAATACCCTTGCTTGGAGTATATCACAGGACCGCACCTACGCGGA
CACCGCAGGTGAGTCTGACACTTTGAGTTTGATGCGCAGCGTGGTGTGCTATTTTTGAGCGGCGGGAAGTCTAAT
AAGACACGGCTTCTCGTCGTCCGGTGCCTTGTTCCGTGTTTCCCGCAGTAATTATGGTTCTGAATCTTCCCATCC
GCAGCCAAGTTCATCAAGACATGGTTTCTTGATGATGCCACTCGCATGAACCCCAACCTTAATTATGGCCAGGTA
AAGCGTGGCCCTGGAAATTCAAACGGCACACATACCGGTCTTTTGTACGGGCCACTGACAATTTCCTCGTTGTGG
AGGAGTTTCTGATCATGCATGCAGGGACCTCAAATGTATGACCAAGGTTGTTAACGGTATCCTCATCTTGCGAAA
GACCAATAGCTCCGCATGGCCCGGCGACATGGATAGTGGAATGAACACCTGGGTCCAGCAATATATCGCGTGGCT
CGAAACTGCTACAATTGCAAATGAAGAACAGTCGGCAGCCAAGTAATTGATTATTATATACTCGATCCAGGCATA
ATGAACTGACGCTCGCCAGTAATCACGGTACATTTTTCTATAATCAGCTCGCTTCTCTCAAAATTCTGCTTGGAG
ATTTTGCTGGCGCAAGAAATGTGACAGATATGTATTTCAATGGTATTTATATGAACCAGATCGTCGAAGGAGGGG
AACAGGTGAATACGCACGTTCTTTAGGTCTTGAAATGTCTCATTCACGTCATTCCAGCCCTTGGAAGCCATACGA
ACTAGACCCTACCATTACCGAGCATACAATTTGGCCGCTATGATTGTATGTTTATATTTCCTTTATGTCGCCCCC
ATTTCCTGATGAATGGTGATATAGACCAATGCACGCCTCGCCCAATATGCAGACCGCAATGCTCCGTCGATGTGG
AATAAGACGACAGAAGAGGGTTCTACCATCAAAGATGCGCTCGATTACGCAATGACGATTTCTCCTAGTGCCAGC
CATGAAGATAATTACGCACAGGAGCTGTATCTCAACGTGGCTGCCGTTGCTTCTGTTTATGGGGACCCCGATGGA
AAATATGCCACATTTTTGGACCAGAAGGAGCCACAGTTTGTACAAGAGCCGTTTTATTTGTGGAACCAGCCGTTT
GCTATGAAGGAGGGATTGGCCGCTGCTCCTAATAATACTAAACCCAACAACAACGCTAGTAATCCGAAGAACAAC
AACAGTGCGATGTCTGGGAGGAGTGTGAACGATATTGGACTATACACAGTTATTCTAAGCTATCTTGTTTATTTG
TTGACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail