Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|114550
Gene name
Locationscaffold_9:251777..253464
Strand+
Gene length (bp)1687
Transcript length (bp)1302
Coding sequence length (bp)1302
Protein length (aa) 434

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18564 Glyco_hydro_5_C Glycoside hydrolase family 5 C-terminal domain 5.0E-20 282 399

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40566|YIS7_YEAST Uncharacterized glycosyl hydrolase YIR007W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIR007W PE=1 SV=1 19 331 1.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|114550
MPSRQTKQTILNEGKKRAWKEDGPTKGQCLWEMHGVWGWCKTKNQAVVLRENYFLKHPVSGKKVDWYTDHYYPFL
KNWADRVLKATSSSKLLFVEPIPNEYCPPSWTEHRLPNMVYAPHWYDLYSLFNKSFGEFSVNVQGLSRGMFPLKA
FYWGHVGARNNYSLQIRNLKEEAYKSLGNVPVIFGECGIPMDMNQGIAFTTEEFLWQRRMMDAMITGFDRSSVGF
NLWNYNPDNTDEHGDNWNGENFSWFSQRRAMPNFLLEYEQNTPHLDGGGRILDAIVRPYPAKVAGTPLDFSYEMM
NGEFTFSWMVPLQGVRDENELGSYETEIFLPSQLTSGRKVLVETDVDWRKHDIDDGVAAQKKLKQWTEEKYAYRY
DEARQTLFIVPKNNSPGTKHAVRVRVSRYYWPFTCCVARCGGDGYEYYLVGLYMRRIQ*
Coding >AgabiH97|114550
ATGCCGTCGAGGCAGACAAAACAAACGATACTGAACGAAGGAAAGAAGAGGGCGTGGAAGGAAGATGGACCGACT
AAGGGACAATGTTTGTGGGAGATGCACGGTGTTTGGGGATGGTGTAAAACCAAAAACCAGGCAGTTGTGTTGAGG
GAGAATTATTTCCTCAAACATCCGGTCAGCGGAAAGAAGGTCGATTGGTACACCGACCATTACTATCCCTTTCTG
AAAAATTGGGCGGATAGAGTGCTGAAAGCGACGTCTTCGAGCAAACTCTTGTTCGTTGAACCTATACCCAATGAG
TATTGCCCTCCTTCCTGGACAGAACACCGCCTTCCCAACATGGTGTATGCGCCACATTGGTACGACTTGTACTCA
CTATTCAATAAGTCCTTTGGCGAATTCTCTGTTAATGTTCAAGGCCTGTCGCGGGGAATGTTCCCTTTGAAAGCT
TTCTACTGGGGTCACGTCGGTGCTCGGAACAACTATAGTCTTCAAATTCGTAATCTGAAAGAAGAAGCATATAAA
TCTCTGGGCAATGTACCCGTGATATTCGGAGAATGTGGTATACCTATGGATATGAACCAAGGAATAGCCTTTACG
ACGGAGGAATTTCTTTGGCAGAGACGGATGATGGATGCTATGATCACCGGCTTCGATCGGTCATCAGTCGGGTTC
AACTTGTGGAACTACAACCCCGATAACACCGACGAACATGGTGATAACTGGAATGGCGAAAATTTTTCTTGGTTT
TCTCAGCGCCGTGCAATGCCCAACTTTTTACTCGAATACGAACAAAACACTCCTCATCTCGATGGTGGTGGTCGC
ATCCTCGATGCAATCGTCCGACCATATCCTGCAAAAGTAGCGGGTACACCGCTCGATTTCAGTTATGAGATGATG
AATGGAGAATTTACGTTCTCGTGGATGGTACCTCTTCAAGGCGTCAGAGATGAAAACGAATTAGGATCTTACGAA
ACTGAAATCTTCTTACCTTCGCAACTCACGTCCGGCAGAAAAGTACTCGTGGAAACTGATGTTGATTGGAGAAAA
CATGACATTGATGATGGAGTCGCGGCGCAGAAGAAGCTAAAACAATGGACAGAAGAAAAATATGCATACAGATAT
GATGAGGCCAGGCAAACGTTGTTCATCGTACCGAAGAATAACTCTCCTGGGACGAAACATGCTGTGAGGGTTAGG
GTGAGTCGTTACTATTGGCCTTTTACTTGCTGTGTTGCTCGCTGCGGCGGCGATGGCTATGAGTACTATTTGGTT
GGGCTATACATGAGAAGGATTCAATAA
Transcript >AgabiH97|114550
ATGCCGTCGAGGCAGACAAAACAAACGATACTGAACGAAGGAAAGAAGAGGGCGTGGAAGGAAGATGGACCGACT
AAGGGACAATGTTTGTGGGAGATGCACGGTGTTTGGGGATGGTGTAAAACCAAAAACCAGGCAGTTGTGTTGAGG
GAGAATTATTTCCTCAAACATCCGGTCAGCGGAAAGAAGGTCGATTGGTACACCGACCATTACTATCCCTTTCTG
AAAAATTGGGCGGATAGAGTGCTGAAAGCGACGTCTTCGAGCAAACTCTTGTTCGTTGAACCTATACCCAATGAG
TATTGCCCTCCTTCCTGGACAGAACACCGCCTTCCCAACATGGTGTATGCGCCACATTGGTACGACTTGTACTCA
CTATTCAATAAGTCCTTTGGCGAATTCTCTGTTAATGTTCAAGGCCTGTCGCGGGGAATGTTCCCTTTGAAAGCT
TTCTACTGGGGTCACGTCGGTGCTCGGAACAACTATAGTCTTCAAATTCGTAATCTGAAAGAAGAAGCATATAAA
TCTCTGGGCAATGTACCCGTGATATTCGGAGAATGTGGTATACCTATGGATATGAACCAAGGAATAGCCTTTACG
ACGGAGGAATTTCTTTGGCAGAGACGGATGATGGATGCTATGATCACCGGCTTCGATCGGTCATCAGTCGGGTTC
AACTTGTGGAACTACAACCCCGATAACACCGACGAACATGGTGATAACTGGAATGGCGAAAATTTTTCTTGGTTT
TCTCAGCGCCGTGCAATGCCCAACTTTTTACTCGAATACGAACAAAACACTCCTCATCTCGATGGTGGTGGTCGC
ATCCTCGATGCAATCGTCCGACCATATCCTGCAAAAGTAGCGGGTACACCGCTCGATTTCAGTTATGAGATGATG
AATGGAGAATTTACGTTCTCGTGGATGGTACCTCTTCAAGGCGTCAGAGATGAAAACGAATTAGGATCTTACGAA
ACTGAAATCTTCTTACCTTCGCAACTCACGTCCGGCAGAAAAGTACTCGTGGAAACTGATGTTGATTGGAGAAAA
CATGACATTGATGATGGAGTCGCGGCGCAGAAGAAGCTAAAACAATGGACAGAAGAAAAATATGCATACAGATAT
GATGAGGCCAGGCAAACGTTGTTCATCGTACCGAAGAATAACTCTCCTGGGACGAAACATGCTGTGAGGGTTAGG
GTGAGTCGTTACTATTGGCCTTTTACTTGCTGTGTTGCTCGCTGCGGCGGCGATGGCTATGAGTACTATTTGGTT
GGGCTATACATGAGAAGGATTCAATAA
Gene >AgabiH97|114550
ATGCCGTCGAGGCAGACAAAACAAACGATACTGAACGAAGGAAAGAAGAGGGCGTGGAAGGAAGATGGACCGACT
AAGGGACAATGTTTGTGGGAGATGCACGGTGTTTGGGGATGGTGTAAAACCAAAAACCAGGCAGTTGTGTTGAGG
GAGAATTATTTCCTCAAACATCCGGTCAGCGGAAAGAAGGTTAGGAGCATACATACAGCTGCTAGGTTTCACTCA
GACTGATTTGGCACAGGTCGATTGGTACACCGACCATTACTATCCCTTTCTGAAAAATTGGGCGGATAGAGTGCT
GAAAGCGACGTCTTCGAGCAAACTCTTGTTCGTTGAACCTATACCCAATGAGGTACACTTTCTTTCGCCACACAC
GCTTCATTTTCAATTACATTGTTATAGTATTGCCCTCCTTCCTGGACAGAACACCGCCTTCCCAACATGGTGTAT
GCGCCACATTGGTACGACTTGTACTCACTATTCAATAAGTCCTTTGGCGAATTCTCTGTTAATGTTCAAGGCCTG
TCGCGGGTAAGTCGTCACTTACTCCACTCTTGTCTTTTTGGTCATCAATAGCACAGGGAATGTTCCCTTTGAAAG
CTTTCTACTGGGGTCACGTCGGTGCTCGGAACAACTATAGTCTTCAAATTCGTAATCTGAAAGAAGAAGCATATA
AATCTCTGGGCAATGTACCCGTGATATTCGGAGAATGTGGTATACCTATGGATATGAAGTAAGAATCAGATTCAT
ATGACTATGTTCCTTGTTGAGGTCGTTCTCTACATTATAGCCAAGGAATAGCCTTTACGACGGAGGAATTTCTTT
GGCAGAGACGGATGATGGATGCTATGATCACCGGCTTCGATCGGTCATCAGTCGGGTTCAAGTACGCTCGCTTCT
CATTCCCTATCAAAGTGTTCTGACTCGTTTGTTATAGCTTGTGGAACTACAACCCCGATAACACCGACGAACATG
GTGATAACTGGAATGGCGAAAATTTTTCTTGGTTTTCTCAGCGCCGTGCAATGCCCAACTTTTTACTCGAATACG
AACAAAACACTCCTCATCTCGATGGTGGTGGTCGCATCCTCGATGCAATCGTCCGACCATATCCTGCAAAAGTAG
CGGGTACACCGCTCGATTTCAGTTATGAGATGATGAATGGAGAATTTACGTTCTCGTGGATGGTACCTCTTCAAG
GCGTCAGAGATGAAAACGAATTAGGATCTTACGAAACTGAAATCTTCTTACCTTCGCAACTCACGTCCGGCAGAA
AAGTACTCGTGGAAACTGATGTTGATTGGAGAAAACATGACATTGATGATGGAGTCGCGGCGCAGAAGAAGCTAA
AACAATGGACAGAAGAAAAATATGCATACAGATATGATGAGGCCAGGCAAACGTTGTTCATCGTACCGAAGAATA
ACTCTCCTGGGACGAAACATGCTGTGAGGGTTAGGGTGTGGCCGCCTATCAGACCGGTGATTAATTTGAATAGTT
TTTGGAGTGACTTTGGTGTAGGAGTCGTTACTATTGGCCTTTTACTTGCTGTGTTGCTCGCTGCGGCGGCGATGG
CTATGAGTACTATTTGGTTGGGCTATACATGAGAAGGTATTGGGTTTCTTGTTTTTGCTGTAGCGTAACTTACAC
TACTATTTTACCCGGAAATGTCTTCAGGATTCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail