Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|114490
Gene name
Locationscaffold_9:242148..243945
Strand-
Gene length (bp)1797
Transcript length (bp)1269
Coding sequence length (bp)1269
Protein length (aa) 423

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00135 COesterase Carboxylesterase family 3.3E-57 23 398
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 1.1E-06 17 95

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22394|LIP2_GEOCN Lipase 2 OS=Geotrichum candidum GN=LIP2 PE=1 SV=2 18 406 1.0E-49
sp|P79066|LIP1_GEOFE Lipase 1 OS=Geotrichum fermentans GN=LIP1 PE=1 SV=1 18 406 1.0E-49
sp|P17573|LIP1_GEOCN Lipase 1 OS=Geotrichum candidum GN=LIP1 PE=1 SV=2 18 406 3.0E-46
sp|D4B1N9|LIP3_ARTBC Probable secreted lipase ARB_02369 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02369 PE=1 SV=1 18 413 4.0E-40
sp|P20261|LIP1_CANRU Lipase 1 OS=Candida rugosa GN=LIP1 PE=1 SV=3 18 421 6.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22394|LIP2_GEOCN Lipase 2 OS=Geotrichum candidum GN=LIP2 PE=1 SV=2 18 406 1.0E-49
sp|P79066|LIP1_GEOFE Lipase 1 OS=Geotrichum fermentans GN=LIP1 PE=1 SV=1 18 406 1.0E-49
sp|P17573|LIP1_GEOCN Lipase 1 OS=Geotrichum candidum GN=LIP1 PE=1 SV=2 18 406 3.0E-46
sp|D4B1N9|LIP3_ARTBC Probable secreted lipase ARB_02369 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02369 PE=1 SV=1 18 413 4.0E-40
sp|P20261|LIP1_CANRU Lipase 1 OS=Candida rugosa GN=LIP1 PE=1 SV=3 18 421 6.0E-37
sp|P32948|LIP4_CANRU Lipase 4 OS=Candida rugosa GN=LIP4 PE=3 SV=1 12 421 9.0E-35
sp|P32947|LIP3_CANRU Lipase 3 OS=Candida rugosa GN=LIP3 PE=1 SV=1 18 421 7.0E-34
sp|P32946|LIP2_CANRU Lipase 2 OS=Candida rugosa GN=LIP2 PE=1 SV=1 18 406 3.0E-33
sp|Q64285|CEL_MOUSE Bile salt-activated lipase OS=Mus musculus GN=Cel PE=1 SV=1 7 387 3.0E-32
sp|Q92035|ACES_BUNFA Acetylcholinesterase OS=Bungarus fasciatus GN=ACHE PE=1 SV=2 24 394 1.0E-30
sp|P21836|ACES_MOUSE Acetylcholinesterase OS=Mus musculus GN=Ache PE=1 SV=1 25 400 1.0E-30
sp|P37136|ACES_RAT Acetylcholinesterase OS=Rattus norvegicus GN=Ache PE=2 SV=1 25 400 2.0E-30
sp|P32949|LIP5_CANRU Lipase 5 OS=Candida rugosa GN=LIP5 PE=3 SV=1 18 421 3.0E-30
sp|D4ASH1|LIP1_ARTBC Secreted lipase ARB07186/07185 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07185 PE=1 SV=2 18 403 5.0E-30
sp|Q8R0W5|EST4A_MOUSE Carboxylesterase 4A OS=Mus musculus GN=Ces4a PE=2 SV=2 19 396 7.0E-30
sp|P22303|ACES_HUMAN Acetylcholinesterase OS=Homo sapiens GN=ACHE PE=1 SV=1 25 400 3.0E-29
sp|P07882|CEL_RAT Bile salt-activated lipase OS=Rattus norvegicus GN=Cel PE=1 SV=2 7 387 7.0E-29
sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 24 370 9.0E-29
sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 24 370 2.0E-28
sp|O62763|ACES_FELCA Acetylcholinesterase OS=Felis catus GN=ACHE PE=3 SV=1 18 400 4.0E-28
sp|P23795|ACES_BOVIN Acetylcholinesterase OS=Bos taurus GN=ACHE PE=1 SV=2 19 400 6.0E-28
sp|Q8BYM5|NLGN3_MOUSE Neuroligin-3 OS=Mus musculus GN=Nlgn3 PE=1 SV=2 24 370 8.0E-28
sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 24 370 8.0E-28
sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 24 370 8.0E-28
sp|Q64176|EST1E_MOUSE Carboxylesterase 1E OS=Mus musculus GN=Ces1e PE=1 SV=1 24 383 1.0E-27
sp|Q29499|ACES_RABIT Acetylcholinesterase (Fragment) OS=Oryctolagus cuniculus GN=ACHE PE=2 SV=1 19 400 2.0E-27
sp|P19835|CEL_HUMAN Bile salt-activated lipase OS=Homo sapiens GN=CEL PE=1 SV=3 7 393 6.0E-27
sp|Q86GC8|ACES_CULPI Acetylcholinesterase OS=Culex pipiens GN=ACHE1 PE=2 SV=2 24 393 1.0E-26
sp|Q9DDE3|ACES_DANRE Acetylcholinesterase OS=Danio rerio GN=ache PE=3 SV=1 18 400 1.0E-26
sp|Q869C3|ACES_ANOGA Acetylcholinesterase OS=Anopheles gambiae GN=Ace PE=3 SV=3 24 393 2.0E-26
sp|P16303|CES1D_RAT Carboxylesterase 1D OS=Rattus norvegicus GN=Ces1d PE=1 SV=2 24 383 3.0E-26
sp|P06276|CHLE_HUMAN Cholinesterase OS=Homo sapiens GN=BCHE PE=1 SV=1 18 416 4.0E-26
sp|Q63108|EST1E_RAT Carboxylesterase 1E OS=Rattus norvegicus GN=Ces1e PE=2 SV=1 24 383 4.0E-26
sp|Q63010|EST5_RAT Liver carboxylesterase B-1 OS=Rattus norvegicus PE=1 SV=1 24 390 5.0E-26
sp|Q8VCT4|CES1D_MOUSE Carboxylesterase 1D OS=Mus musculus GN=Ces1d PE=1 SV=1 24 383 1.0E-25
sp|P21927|CHLE_RABIT Cholinesterase OS=Oryctolagus cuniculus GN=BCHE PE=2 SV=1 18 396 1.0E-25
sp|P0C6R3|EST4A_BOVIN Carboxylesterase 4A OS=Bos taurus GN=CES4A PE=2 SV=1 24 394 2.0E-25
sp|Q27677|ACES_LEPDE Acetylcholinesterase OS=Leptinotarsa decemlineata PE=2 SV=1 18 396 3.0E-25
sp|Q5GRG2|EST5A_RAT Carboxylesterase 5A OS=Rattus norvegicus GN=Ces5a PE=1 SV=1 24 394 4.0E-25
sp|Q8VCC2|EST1_MOUSE Liver carboxylesterase 1 OS=Mus musculus GN=Ces1 PE=1 SV=1 29 383 4.0E-25
sp|Q6NT32|EST5A_HUMAN Carboxylesterase 5A OS=Homo sapiens GN=CES5A PE=2 SV=1 24 420 7.0E-25
sp|P30122|CEL_BOVIN Bile salt-activated lipase (Fragment) OS=Bos taurus GN=CEL PE=1 SV=2 7 394 7.0E-25
sp|Q6AW47|EST5A_CANLF Carboxylesterase 5A OS=Canis lupus familiaris GN=CES5A PE=2 SV=1 24 394 8.0E-25
sp|Q3T930|EST5A_SHEEP Carboxylesterase 5A (Fragment) OS=Ovis aries GN=CES5A PE=1 SV=1 24 366 9.0E-25
sp|Q29550|EST1_PIG Liver carboxylesterase OS=Sus scrofa PE=1 SV=1 24 390 1.0E-24
sp|O42275|ACES_ELEEL Acetylcholinesterase OS=Electrophorus electricus GN=ache PE=3 SV=1 18 400 2.0E-24
sp|Q64573|EST4_RAT Liver carboxylesterase 4 OS=Rattus norvegicus PE=2 SV=2 24 390 2.0E-24
sp|O62760|CHLE_FELCA Cholinesterase OS=Felis catus GN=BCHE PE=2 SV=1 18 396 2.0E-24
sp|P04058|ACES_TORCA Acetylcholinesterase OS=Torpedo californica GN=ache PE=1 SV=2 18 400 3.0E-24
sp|P10959|EST1C_RAT Carboxylesterase 1C OS=Rattus norvegicus GN=Ces1c PE=1 SV=3 24 383 4.0E-24
sp|O62761|CHLE_PANTT Cholinesterase OS=Panthera tigris tigris GN=BCHE PE=2 SV=1 18 396 4.0E-24
sp|Q8I034|EST5A_FELCA Carboxylesterase 5A OS=Felis catus GN=CES5A PE=1 SV=1 24 394 4.0E-24
sp|P81908|CHLE_HORSE Cholinesterase OS=Equus caballus GN=BCHE PE=1 SV=1 18 396 9.0E-24
sp|Q04791|SASB_ANAPL Fatty acyl-CoA hydrolase precursor, medium chain OS=Anas platyrhynchos PE=1 SV=1 24 394 1.0E-23
sp|P32749|CHLE_BOVIN Cholinesterase OS=Bos taurus GN=BCHE PE=2 SV=2 18 412 2.0E-23
sp|P07692|ACES_TORMA Acetylcholinesterase OS=Torpedo marmorata GN=ache PE=1 SV=2 18 400 2.0E-23
sp|Q91WG0|EST2C_MOUSE Acylcarnitine hydrolase OS=Mus musculus GN=Ces2c PE=1 SV=1 24 394 3.0E-23
sp|Q8BK48|EST2E_MOUSE Pyrethroid hydrolase Ces2e OS=Mus musculus GN=Ces2e PE=1 SV=1 24 394 5.0E-23
sp|P37967|PNBA_BACSU Para-nitrobenzyl esterase OS=Bacillus subtilis (strain 168) GN=pnbA PE=1 SV=2 17 396 7.0E-23
sp|P86325|EST1_THEFU Carboxylesterase OS=Thermobifida fusca PE=1 SV=1 24 405 7.0E-23
sp|P23953|EST1C_MOUSE Carboxylesterase 1C OS=Mus musculus GN=Ces1c PE=1 SV=4 24 383 9.0E-23
sp|Q47M62|EST1_THEFY Carboxylesterase OS=Thermobifida fusca (strain YX) GN=Tfu_2427 PE=3 SV=1 24 405 9.0E-23
sp|Q5XG92|EST4A_HUMAN Carboxylesterase 4A OS=Homo sapiens GN=CES4A PE=2 SV=2 24 394 1.0E-22
sp|Q03311|CHLE_MOUSE Cholinesterase OS=Mus musculus GN=Bche PE=1 SV=2 18 396 2.0E-22
sp|P12337|EST1_RABIT Liver carboxylesterase 1 OS=Oryctolagus cuniculus PE=1 SV=3 24 383 8.0E-22
sp|Q8QZR3|EST2A_MOUSE Pyrethroid hydrolase Ces2a OS=Mus musculus GN=Ces2a PE=1 SV=1 17 394 1.0E-21
sp|O46421|EST1_MACFA Liver carboxylesterase 1 OS=Macaca fascicularis GN=CES1 PE=2 SV=1 24 390 1.0E-21
sp|Q27459|ACE1_CAEBR Acetylcholinesterase 1 OS=Caenorhabditis briggsae GN=ace-1 PE=3 SV=1 24 385 2.0E-21
sp|Q64419|EST1_MESAU Liver carboxylesterase OS=Mesocricetus auratus PE=2 SV=1 24 390 2.0E-21
sp|P38433|ACE1_CAEEL Acetylcholinesterase 1 OS=Caenorhabditis elegans GN=ace-1 PE=1 SV=1 24 385 1.0E-20
sp|P14943|EST2_RABIT Liver carboxylesterase 2 OS=Oryctolagus cuniculus GN=CES2 PE=1 SV=2 24 374 2.0E-20
sp|Q6AW46|EST5A_MOUSE Carboxylesterase 5A OS=Mus musculus GN=Ces5a PE=2 SV=1 24 394 3.0E-20
sp|Q6UWW8|EST3_HUMAN Carboxylesterase 3 OS=Homo sapiens GN=CES3 PE=1 SV=1 24 412 8.0E-20
sp|D2D3B6|FUMD_SPHMC Fumonisin B1 esterase OS=Sphingopyxis macrogoltabida GN=fumD PE=1 SV=1 24 382 1.0E-19
sp|Q5RCL7|EST3_PONAB Carboxylesterase 3 OS=Pongo abelii GN=CES3 PE=2 SV=2 24 412 2.0E-19
sp|P25727|EST5A_DROPS Esterase-5A OS=Drosophila pseudoobscura pseudoobscura GN=Est-5A PE=3 SV=3 18 399 3.0E-19
sp|O00748|EST2_HUMAN Cocaine esterase OS=Homo sapiens GN=CES2 PE=1 SV=1 24 390 5.0E-19
sp|B0F2B4|NLGN4_MOUSE Neuroligin 4-like OS=Mus musculus GN=Nlgn4l PE=1 SV=1 24 218 5.0E-19
sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 24 370 6.0E-19
sp|Q9NDG8|ACE4_CAEBR Acetylcholinesterase 4 OS=Caenorhabditis briggsae GN=ace-4 PE=2 SV=1 18 387 7.0E-19
sp|O16173|EST5A_DROPE Esterase-5A OS=Drosophila persimilis GN=Est-5A PE=3 SV=1 18 399 1.0E-18
sp|P23141|EST1_HUMAN Liver carboxylesterase 1 OS=Homo sapiens GN=CES1 PE=1 SV=2 24 383 1.0E-18
sp|Q8N2Q7|NLGN1_HUMAN Neuroligin-1 OS=Homo sapiens GN=NLGN1 PE=1 SV=2 24 370 1.0E-18
sp|Q62888|NLGN2_RAT Neuroligin-2 OS=Rattus norvegicus GN=Nlgn2 PE=1 SV=1 24 370 2.0E-18
sp|P07140|ACES_DROME Acetylcholinesterase OS=Drosophila melanogaster GN=Ace PE=1 SV=1 24 388 2.0E-18
sp|Q8NFZ4|NLGN2_HUMAN Neuroligin-2 OS=Homo sapiens GN=NLGN2 PE=1 SV=1 24 370 2.0E-18
sp|Q99K10|NLGN1_MOUSE Neuroligin-1 OS=Mus musculus GN=Nlgn1 PE=1 SV=2 24 370 3.0E-18
sp|Q62765|NLGN1_RAT Neuroligin-1 OS=Rattus norvegicus GN=Nlgn1 PE=1 SV=1 24 370 4.0E-18
sp|P35501|ESTE_MYZPE Esterase E4 OS=Myzus persicae PE=1 SV=1 24 217 5.0E-18
sp|P35502|ESTF_MYZPE Esterase FE4 OS=Myzus persicae PE=1 SV=1 24 217 2.0E-17
sp|O16168|EST5A_DROMI Esterase-5A OS=Drosophila miranda GN=Est-5A PE=3 SV=1 18 399 3.0E-17
sp|Q95000|CHLE1_BRALA Cholinesterase 1 (Fragment) OS=Branchiostoma lanceolatum GN=CHE1 PE=3 SV=1 18 218 4.0E-17
sp|Q95001|CHLE2_BRALA Cholinesterase 2 (Fragment) OS=Branchiostoma lanceolatum GN=CHE2 PE=3 SV=1 18 218 3.0E-16
sp|Q8VCU1|EST3B_MOUSE Carboxylesterase 3B OS=Mus musculus GN=Ces3b PE=1 SV=2 24 382 7.0E-16
sp|W4VSJ0|ACES_TRILK Acetylcholinesterase-1 OS=Trittame loki PE=1 SV=1 24 412 7.0E-16
sp|O16169|EST5C_DROMI Esterase-5C OS=Drosophila miranda GN=Est-5C PE=3 SV=1 18 214 8.0E-16
sp|P25726|EST5B_DROPS Esterase-5B OS=Drosophila pseudoobscura pseudoobscura GN=Est-5B PE=2 SV=2 20 214 9.0E-16
sp|Q01470|PCD_ARTOX Phenmedipham hydrolase OS=Arthrobacter oxydans GN=pcd PE=1 SV=1 19 406 1.0E-15
sp|O16171|EST5C_DROPE Esterase-5C OS=Drosophila persimilis GN=Est-5C PE=3 SV=1 18 214 1.0E-15
sp|Q63880|EST3A_MOUSE Carboxylesterase 3A OS=Mus musculus GN=Ces3a PE=1 SV=2 24 382 1.0E-15
sp|P16854|EST1_CULPI Esterase B1 OS=Culex pipiens GN=B1 PE=3 SV=1 24 372 1.0E-15
sp|P25725|EST5C_DROPS Esterase-5C OS=Drosophila pseudoobscura pseudoobscura GN=Est-5C PE=3 SV=1 18 214 2.0E-15
sp|O16172|EST5B_DROPE Esterase-5B OS=Drosophila persimilis GN=Est-5B PE=3 SV=1 20 214 2.0E-15
sp|P56161|ACES_ANOST Acetylcholinesterase OS=Anopheles stephensi PE=3 SV=1 24 397 2.0E-15
sp|Q92081|ACES_MYXGL Acetylcholinesterase (Fragment) OS=Myxine glutinosa GN=ache PE=3 SV=1 18 287 8.0E-15
sp|O16170|EST5B_DROMI Esterase-5B OS=Drosophila miranda GN=Est-5B PE=3 SV=1 20 214 1.0E-14
sp|P18167|ESTP_DROME Esterase P OS=Drosophila melanogaster GN=Est-P PE=2 SV=2 18 214 1.0E-14
sp|Q08662|EST6_DROSI Esterase 6 OS=Drosophila simulans GN=Est-6 PE=3 SV=1 5 214 5.0E-14
sp|P18142|D2_DICDI cAMP-regulated D2 protein OS=Dictyostelium discoideum GN=D2 PE=2 SV=3 24 391 2.0E-13
sp|P08171|EST6_DROME Esterase-6 OS=Drosophila melanogaster GN=Est-6 PE=1 SV=2 5 214 2.0E-13
sp|P47982|EST6_DROMA Esterase 6 OS=Drosophila mauritiana GN=Est-6 PE=3 SV=1 5 214 2.0E-13
sp|P21837|CRYS_DICDI Crystal protein OS=Dictyostelium discoideum GN=cryS PE=1 SV=1 22 218 6.0E-13
sp|D4AZ78|LIP2_ARTBC Secreted lipase ARB_01498 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01498 PE=1 SV=1 25 155 2.0E-12
sp|B2D0J5|EST6_APIME Venom carboxylesterase-6 OS=Apis mellifera PE=2 SV=1 24 371 3.0E-12
sp|P01266|THYG_HUMAN Thyroglobulin OS=Homo sapiens GN=TG PE=1 SV=5 24 229 8.0E-12
sp|Q07085|EST2_CAEEL Esterase CM06B1 OS=Caenorhabditis elegans GN=F13H6.3 PE=3 SV=3 24 416 1.0E-11
sp|Q5UR02|CHLE_MIMIV Probable cholinesterase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L906 PE=3 SV=1 24 397 2.0E-11
sp|O08710|THYG_MOUSE Thyroglobulin OS=Mus musculus GN=Tg PE=1 SV=3 24 231 3.0E-11
sp|P32752|CHLE_PIG Cholinesterase (Fragment) OS=Sus scrofa GN=BCHE PE=2 SV=1 17 92 6.0E-11
sp|P06882|THYG_RAT Thyroglobulin OS=Rattus norvegicus GN=Tg PE=1 SV=4 24 231 8.0E-11
sp|P32750|CHLE_CANLF Cholinesterase (Fragment) OS=Canis lupus familiaris GN=BCHE PE=2 SV=1 18 87 8.0E-11
sp|P32753|CHLE_SHEEP Cholinesterase (Fragment) OS=Ovis aries GN=BCHE PE=2 SV=1 18 87 1.0E-10
sp|P32751|CHLE_MACMU Cholinesterase (Fragment) OS=Macaca mulatta GN=BCHE PE=2 SV=1 18 87 1.0E-10
sp|P36196|ACES_CHICK Acetylcholinesterase OS=Gallus gallus GN=ACHE PE=2 SV=1 25 112 2.0E-10
sp|P33438|GLT_DROME Glutactin OS=Drosophila melanogaster GN=Glt PE=1 SV=2 24 396 5.0E-10
sp|P01267|THYG_BOVIN Thyroglobulin OS=Bos taurus GN=TG PE=1 SV=1 24 231 7.0E-10
sp|Q04456|EST1_CAEBR Gut esterase 1 OS=Caenorhabditis briggsae GN=ges-1 PE=2 SV=1 24 416 2.0E-09
sp|Q05487|ESTS_DROVI Esterase S OS=Drosophila virilis GN=EstS PE=2 SV=1 51 230 2.0E-09
sp|Q99156|LIP1_YARLI Lipase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP1 PE=3 SV=2 18 112 4.0E-09
sp|O94493|YC7C_SCHPO Uncharacterized esterase/lipase C417.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.12 PE=3 SV=2 19 404 6.0E-09
sp|Q9XTG1|NLGN1_CAEEL Neuroligin-1 OS=Caenorhabditis elegans GN=nlg-1 PE=1 SV=1 24 370 8.0E-09
sp|P12992|ESTJ_HELVI Juvenile hormone esterase OS=Heliothis virescens PE=1 SV=2 24 380 1.0E-08
sp|Q9UKY3|CES1P_HUMAN Putative inactive carboxylesterase 4 OS=Homo sapiens GN=CES1P1 PE=5 SV=2 24 117 1.0E-08
sp|Q04457|EST1_CAEEL Gut esterase 1 OS=Caenorhabditis elegans GN=ges-1 PE=1 SV=1 24 182 5.0E-08
sp|Q96VC9|LIP3_YARLI Lipase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP3 PE=3 SV=1 18 115 2.0E-07
sp|P36196|ACES_CHICK Acetylcholinesterase OS=Gallus gallus GN=ACHE PE=2 SV=1 298 394 3.0E-07
sp|P23654|NRT_DROME Neurotactin OS=Drosophila melanogaster GN=Nrt PE=1 SV=3 17 178 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 10.55 5.17 15.92
Initials Initials knots 7.94 3.76 12.12
Pileal_Stipeal_center Stage I stipe center 4.45 1.85 7.06
Pileal_Stipeal_shell Stage I stipe shell 4.35 1.86 6.85
DIF_stipe_center Stage II stipe center 1.95 0.69 3.21
DIF_stipe_shell Stage II stipe shell 1.56 0.49 2.62
DIF_stipe_skin Stage II stipe skin 3.21 1.28 5.13
DIF_cap_skin Stage II cap skin 3.48 1.38 5.58
DIF_cap_tissue Stage II cap tissue 3.27 1.32 5.22
DIF_gill_tissue Stage II gill tissue 3.78 1.58 5.98
YFB_stipe_center Young fruiting body stipe center 3.03 1.13 4.93
YFB_stipe_shell Young fruiting body stipe shell 2.01 0.71 3.30
YFB_stipe_skin Young fruiting body stipe skin 2.60 1.00 4.20
YFB_cap_skin Young fruiting body cap skin 1.78 0.61 2.96
YFB_cap_tissue Young fruiting body cap tissue 1.60 0.51 2.69
YFB_gill_tissue Young fruiting body gill tissue 2.65 1.02 4.27
YFB_veil Young fruiting body veil 2.42 0.88 3.96

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.001625 yes
Casing YFB_stipe_center 0.001140 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.533921 no
Casing Pileal_Stipeal_center 0.017507 yes
Casing Pileal_Stipeal_shell 0.010412 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.001140 yes
Casing DIF_cap_tissue 0.001625 yes
DIF_gill_tissue YFB_stipe_center 0.712925 no
DIF_gill_tissue YFB_stipe_shell 0.139707 no
DIF_gill_tissue YFB_stipe_skin 0.451513 no
DIF_gill_tissue YFB_cap_skin 0.075556 no
DIF_gill_tissue YFB_cap_tissue 0.048626 yes
DIF_gill_tissue YFB_gill_tissue 0.478862 no
DIF_gill_tissue YFB_veil 0.358057 no
YFB_stipe_center YFB_stipe_shell 0.435715 no
YFB_stipe_center YFB_stipe_skin 0.832596 no
YFB_stipe_center YFB_cap_skin 0.276817 no
YFB_stipe_center YFB_cap_tissue 0.189035 no
YFB_stipe_center YFB_gill_tissue 0.853129 no
YFB_stipe_center YFB_veil 0.735680 no
YFB_stipe_shell YFB_stipe_skin 0.677959 no
YFB_stipe_shell YFB_cap_skin 0.880651 no
YFB_stipe_shell YFB_cap_tissue 0.742064 no
YFB_stipe_shell YFB_gill_tissue 0.646312 no
YFB_stipe_shell YFB_veil 0.791691 no
YFB_stipe_skin YFB_cap_skin 0.488243 no
YFB_stipe_skin YFB_cap_tissue 0.358922 no
YFB_stipe_skin YFB_gill_tissue 0.983066 no
YFB_stipe_skin YFB_veil 0.931053 no
YFB_cap_skin YFB_cap_tissue 0.894461 no
YFB_cap_skin YFB_gill_tissue 0.456331 no
YFB_cap_skin YFB_veil 0.609752 no
YFB_cap_tissue YFB_gill_tissue 0.326217 no
YFB_cap_tissue YFB_veil 0.465448 no
YFB_gill_tissue YFB_veil 0.911073 no
Initials DIF_gill_tissue 0.045701 yes
Initials YFB_stipe_center 0.013485 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.002084 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.002084 yes
Initials YFB_veil 0.001625 yes
Initials Pileal_Stipeal_center 0.154913 no
Initials Pileal_Stipeal_shell 0.121416 no
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.013186 yes
Initials DIF_cap_skin 0.028437 yes
Initials DIF_cap_tissue 0.019715 yes
Pileal_Stipeal_center DIF_gill_tissue 0.802005 no
Pileal_Stipeal_center YFB_stipe_center 0.455274 no
Pileal_Stipeal_center YFB_stipe_shell 0.055381 no
Pileal_Stipeal_center YFB_stipe_skin 0.239320 no
Pileal_Stipeal_center YFB_cap_skin 0.024946 yes
Pileal_Stipeal_center YFB_cap_tissue 0.017507 yes
Pileal_Stipeal_center YFB_gill_tissue 0.257577 no
Pileal_Stipeal_center YFB_veil 0.178958 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.978142 no
Pileal_Stipeal_center DIF_stipe_center 0.046117 yes
Pileal_Stipeal_center DIF_stipe_shell 0.015529 yes
Pileal_Stipeal_center DIF_stipe_skin 0.538175 no
Pileal_Stipeal_center DIF_cap_skin 0.679367 no
Pileal_Stipeal_center DIF_cap_tissue 0.576211 no
Pileal_Stipeal_shell DIF_gill_tissue 0.830414 no
Pileal_Stipeal_shell YFB_stipe_center 0.475513 no
Pileal_Stipeal_shell YFB_stipe_shell 0.058147 no
Pileal_Stipeal_shell YFB_stipe_skin 0.251119 no
Pileal_Stipeal_shell YFB_cap_skin 0.029164 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.020790 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.267670 no
Pileal_Stipeal_shell YFB_veil 0.185817 no
Pileal_Stipeal_shell DIF_stipe_center 0.048007 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.017226 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.561022 no
Pileal_Stipeal_shell DIF_cap_skin 0.703049 no
Pileal_Stipeal_shell DIF_cap_tissue 0.599588 no
DIF_stipe_center DIF_gill_tissue 0.125142 no
DIF_stipe_center YFB_stipe_center 0.394416 no
DIF_stipe_center YFB_stipe_shell 0.971555 no
DIF_stipe_center YFB_stipe_skin 0.630938 no
DIF_stipe_center YFB_cap_skin 0.916714 no
DIF_stipe_center YFB_cap_tissue 0.786418 no
DIF_stipe_center YFB_gill_tissue 0.600946 no
DIF_stipe_center YFB_veil 0.750665 no
DIF_stipe_center DIF_stipe_shell 0.753513 no
DIF_stipe_center DIF_stipe_skin 0.300294 no
DIF_stipe_center DIF_cap_skin 0.204693 no
DIF_stipe_center DIF_cap_tissue 0.282996 no
DIF_stipe_shell DIF_gill_tissue 0.041164 yes
DIF_stipe_shell YFB_stipe_center 0.164242 no
DIF_stipe_shell YFB_stipe_shell 0.702647 no
DIF_stipe_shell YFB_stipe_skin 0.321718 no
DIF_stipe_shell YFB_cap_skin 0.865762 no
DIF_stipe_shell YFB_cap_tissue 0.978115 no
DIF_stipe_shell YFB_gill_tissue 0.295530 no
DIF_stipe_shell YFB_veil 0.431684 no
DIF_stipe_shell DIF_stipe_skin 0.108995 no
DIF_stipe_shell DIF_cap_skin 0.072685 no
DIF_stipe_shell DIF_cap_tissue 0.107767 no
DIF_stipe_skin DIF_gill_tissue 0.800559 no
DIF_stipe_skin YFB_stipe_center 0.945318 no
DIF_stipe_skin YFB_stipe_shell 0.340458 no
DIF_stipe_skin YFB_stipe_skin 0.743827 no
DIF_stipe_skin YFB_cap_skin 0.208566 no
DIF_stipe_skin YFB_cap_tissue 0.140702 no
DIF_stipe_skin YFB_gill_tissue 0.766930 no
DIF_stipe_skin YFB_veil 0.638541 no
DIF_stipe_skin DIF_cap_skin 0.916321 no
DIF_stipe_skin DIF_cap_tissue 0.981920 no
DIF_cap_skin DIF_gill_tissue 0.913456 no
DIF_cap_skin YFB_stipe_center 0.845210 no
DIF_cap_skin YFB_stipe_shell 0.234633 no
DIF_cap_skin YFB_stipe_skin 0.603896 no
DIF_cap_skin YFB_cap_skin 0.134284 no
DIF_cap_skin YFB_cap_tissue 0.083158 no
DIF_cap_skin YFB_gill_tissue 0.630560 no
DIF_cap_skin YFB_veil 0.497077 no
DIF_cap_skin DIF_cap_tissue 0.936834 no
DIF_cap_tissue DIF_gill_tissue 0.832337 no
DIF_cap_tissue YFB_stipe_center 0.925065 no
DIF_cap_tissue YFB_stipe_shell 0.315328 no
DIF_cap_tissue YFB_stipe_skin 0.716723 no
DIF_cap_tissue YFB_cap_skin 0.189160 no
DIF_cap_tissue YFB_cap_tissue 0.122767 no
DIF_cap_tissue YFB_gill_tissue 0.741519 no
DIF_cap_tissue YFB_veil 0.611613 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|114490
MLALLIFLDSWRWLPIRVARGTPLICVSFNYRLGPLGYPQGKEAAHQRSLNLGLRDQIAALEWVQHNIDAFGGDK
NKVTIAGESAGAIMNSILYLNSPLDKLVRGAILESGSQATSMNFYPKRREGNWENFVAGVESCASTATSGHTFDC
LRTANELEIYSGIMNSIKKSPEVFPFFPTIDGPGGLYPDVPSRLFSRGKFARVPFISGTNLDEGTMFVPPTINSE
EEIRQYIIANYSPPIVPPAELDRAVDKLLQLYPDIPALGSPFNTGDETFHLPSSFKRISALVGDLWFQSQRRFWQ
QTATKAGVKSWGYLFTHSDPFLHPPFLGVAHSDEVTYVYGVPNDPSPSSHSLSKVMMDYWISFVTSLDPNDGKGD
ERPLWEQYASDNERLIQFDGDGIEMIDDSFRKAQMDYINSIPLVFLH*
Coding >AgabiH97|114490
ATGCTCGCCCTATTAATTTTTTTGGACTCATGGCGGTGGCTTCCTATACGCGTCGCTAGAGGAACTCCTTTGATC
TGTGTCAGTTTTAATTACCGTCTTGGTCCACTTGGTTACCCTCAAGGCAAAGAAGCTGCCCATCAAAGATCACTT
AATTTGGGGCTACGAGATCAGATCGCTGCATTGGAATGGGTTCAACATAATATAGATGCGTTTGGTGGAGATAAG
AACAAGGTTACTATTGCTGGGGAAAGCGCAGGAGCCATCATGAATTCCATCCTTTACCTGAATTCACCTCTCGAT
AAACTCGTTCGCGGAGCGATTCTCGAGTCAGGCAGTCAAGCCACTTCCATGAACTTTTATCCCAAGCGCAGAGAA
GGCAATTGGGAAAATTTTGTCGCCGGTGTTGAATCCTGTGCCTCCACTGCGACTTCTGGTCATACTTTTGACTGC
TTGCGGACGGCCAATGAATTAGAAATATATTCAGGAATAATGAACTCTATCAAAAAATCTCCCGAAGTGTTTCCC
TTCTTCCCCACTATTGATGGACCTGGTGGGTTATATCCCGATGTGCCATCAAGGTTATTTTCGAGAGGGAAATTT
GCGCGGGTACCATTCATAAGTGGAACTAATCTTGACGAAGGTACCATGTTTGTTCCTCCGACAATCAATTCTGAA
GAGGAGATCCGTCAGTATATCATTGCCAATTACTCCCCTCCTATCGTTCCACCGGCCGAACTCGACAGGGCAGTG
GACAAGTTATTGCAGCTATATCCCGATATTCCGGCTCTTGGTTCTCCGTTTAACACCGGTGATGAAACATTCCAC
TTACCTTCATCATTCAAACGTATTTCCGCGCTCGTTGGCGATCTTTGGTTCCAGTCGCAGCGGCGATTCTGGCAA
CAGACAGCCACGAAGGCGGGCGTCAAGAGTTGGGGATATCTATTTACACATTCTGATCCATTCCTTCACCCACCC
TTCCTCGGAGTCGCTCACTCGGACGAGGTAACATATGTATACGGAGTGCCAAATGATCCATCCCCCTCGTCCCAT
TCATTGAGTAAGGTCATGATGGATTATTGGATTTCATTTGTAACAAGCTTGGATCCAAATGACGGAAAAGGCGAC
GAACGACCTCTATGGGAACAGTACGCCAGTGACAATGAACGTCTGATCCAGTTTGACGGCGATGGCATCGAAATG
ATCGATGATTCATTCCGCAAAGCACAGATGGACTACATCAATTCTATTCCCCTTGTATTTTTGCATTGA
Transcript >AgabiH97|114490
ATGCTCGCCCTATTAATTTTTTTGGACTCATGGCGGTGGCTTCCTATACGCGTCGCTAGAGGAACTCCTTTGATC
TGTGTCAGTTTTAATTACCGTCTTGGTCCACTTGGTTACCCTCAAGGCAAAGAAGCTGCCCATCAAAGATCACTT
AATTTGGGGCTACGAGATCAGATCGCTGCATTGGAATGGGTTCAACATAATATAGATGCGTTTGGTGGAGATAAG
AACAAGGTTACTATTGCTGGGGAAAGCGCAGGAGCCATCATGAATTCCATCCTTTACCTGAATTCACCTCTCGAT
AAACTCGTTCGCGGAGCGATTCTCGAGTCAGGCAGTCAAGCCACTTCCATGAACTTTTATCCCAAGCGCAGAGAA
GGCAATTGGGAAAATTTTGTCGCCGGTGTTGAATCCTGTGCCTCCACTGCGACTTCTGGTCATACTTTTGACTGC
TTGCGGACGGCCAATGAATTAGAAATATATTCAGGAATAATGAACTCTATCAAAAAATCTCCCGAAGTGTTTCCC
TTCTTCCCCACTATTGATGGACCTGGTGGGTTATATCCCGATGTGCCATCAAGGTTATTTTCGAGAGGGAAATTT
GCGCGGGTACCATTCATAAGTGGAACTAATCTTGACGAAGGTACCATGTTTGTTCCTCCGACAATCAATTCTGAA
GAGGAGATCCGTCAGTATATCATTGCCAATTACTCCCCTCCTATCGTTCCACCGGCCGAACTCGACAGGGCAGTG
GACAAGTTATTGCAGCTATATCCCGATATTCCGGCTCTTGGTTCTCCGTTTAACACCGGTGATGAAACATTCCAC
TTACCTTCATCATTCAAACGTATTTCCGCGCTCGTTGGCGATCTTTGGTTCCAGTCGCAGCGGCGATTCTGGCAA
CAGACAGCCACGAAGGCGGGCGTCAAGAGTTGGGGATATCTATTTACACATTCTGATCCATTCCTTCACCCACCC
TTCCTCGGAGTCGCTCACTCGGACGAGGTAACATATGTATACGGAGTGCCAAATGATCCATCCCCCTCGTCCCAT
TCATTGAGTAAGGTCATGATGGATTATTGGATTTCATTTGTAACAAGCTTGGATCCAAATGACGGAAAAGGCGAC
GAACGACCTCTATGGGAACAGTACGCCAGTGACAATGAACGTCTGATCCAGTTTGACGGCGATGGCATCGAAATG
ATCGATGATTCATTCCGCAAAGCACAGATGGACTACATCAATTCTATTCCCCTTGTATTTTTGCATTGA
Gene >AgabiH97|114490
ATGCTCGCCCTATTAATTTTTTTGGACGTGGGTGATTTTGCACTTCCAGAGAAATTGATCTCTGATCGCAGGATG
CAGTCATGGCGGTGGCTTCCTATACGGTAGCTCGACGGAGTATAATGCCAGTCTTATTGTCGCACGTAGCGTCGC
TAGAGTAAACGTTTACTATGATTTTCTTGTTTCATCTCTTCATTTCTCTTTCAGGGAACTCCTTTGATCTGTGTC
AGTTTTAATTACCGTCTTGGTCCACTTGGTTACCCTCAAGGCAAAGAAGGTTAGTCATTGCATTAATTTGGTACT
ACACATTGATTGTGATTCTGTTGCAGCTGCCCATCAAAGATCACTTAATTTGGGGCTACGAGATCAGATCGCTGC
ATTGGAATGGGTTCAACATAATATAGATGCGTTTGGTGGAGATAAGAACAAGGTTTGTTGTAATGTTATTCTGGA
TTTAATCGGACGCAATTGATTGTGCCTGTACTTAGGTTACTATTGCTGGGGAAAGCGCAGGAGCCATCATGAATT
CCATCCTTTACCTGAATTCACCTCTCGATAAACTCGTTCGCGGAGCGGCATGTGTCATCTTTTGCCTTTTTTTTT
GAATGGTTTTTTGACGGACGGAGTAGATTCTCGAGTCAGGCAGTCAAGCCACTTCCATGAACTTTTATCCCAAGC
GCAGAGAAGGCAATTGGGAAAATTTTGTCGCCGGTGTTGAATCCTGTGCCTCCACTGCGACTTCTGGTCATACTT
TTGACTGCTTGCGGACGGCCAATGAATTAGAAATATATTCAGGAATAATGAACTCTATCAAAAAATCTCCCGAAG
TGTTTCCCTTCTTCCCCACTATTGATGGACCTGGTGGGTTATATCCCGATGTGCCATCAAGGTTATTTTCGAGAG
GGAAATTTGCGCGGGTACCATTCATAAGTGGAACTAATCTTGACGAAGGTGAGTCTAGCTCCGGTGTCGGTTAAC
GGCGTGTAAGTCAATCTCTCATCTAGGTACCATGTTTGTTCCTCCGACAATCAATTCTGAAGAGGAGATCCGTCA
GTATATCATTGCCAATTACTCCCCTCCTATCGTTCCACCGGCCGAACTCGACAGGGCAGTGGACAAGTTATTGCA
GCTATATCCCGATATTCCGGCTCTTGGTTCTCCGTTTAACACCGGTGATGAAACATTCCACTTACCTTCATCATT
CAAACGTATTTCCGCGCTCGGTAAGGACCTTACTTCCTTTAAGCTCTATTTTCCTTCTCATGCTCATTTTCAGTT
GGCGATCTTTGGTTCCAGTCGCAGCGGCGATTCTGGCAACAGACAGCCACGAAGGCGGGCGTCAAGAGTTGGGGA
TATCTATTTACACATTCTGATCCATTCCTTCACCCACCCTTCCTCGGAGGTAAGATCTTATCCTCGTTTGAGCTA
CCCTTTGGCATGGTACTCAATTCCATGGTACAGTCGCTCACTCGGACGAGGTAACATATGTATACGGAGTGCCAA
ATGATCCATCCCCCTCGTCCCATTCATTGAGTAAGGTCATGATGGATTATTGGATTTCATTTGTAACAAGCTTGG
ATCCAAATGACGGAAAAGGCGACGAACGTAGGTGGTTATATTCTGTTTGATTTAACTTACTGACAGTTTTCATAT
TGTGTAGGACCTCTATGGGAACAGTACGCCAGTGACAATGAACGTCTGATCCAGTTTGACGGCGATGGCATCGAA
ATGATCGATGATTCATTCCGCAAAGCACAGATGGACTACATCAATTCTATTCCCCTTGTATTTTTGCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail