Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|114410
Gene name
Locationscaffold_9:226404..228156
Strand+
Gene length (bp)1752
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00344 SecY SecY 1.2E-73 76 457
PF10559 Plug_translocon Plug domain of Sec61p 7.7E-18 41 75

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q25147|SC61A_HALRO Protein transport protein Sec61 subunit alpha OS=Halocynthia roretzi PE=2 SV=1 3 477 0.0E+00
sp|P61620|S61A1_MOUSE Protein transport protein Sec61 subunit alpha isoform 1 OS=Mus musculus GN=Sec61a1 PE=1 SV=2 5 477 0.0E+00
sp|P61619|S61A1_HUMAN Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens GN=SEC61A1 PE=1 SV=2 5 477 0.0E+00
sp|P38377|S61A1_CANLF Protein transport protein Sec61 subunit alpha isoform 1 OS=Canis lupus familiaris GN=SEC61A1 PE=1 SV=3 5 477 0.0E+00
sp|Q8AY33|SC61A_BORSA Protein transport protein Sec61 subunit alpha OS=Boreogadus saida GN=sec61a PE=2 SV=3 3 477 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q25147|SC61A_HALRO Protein transport protein Sec61 subunit alpha OS=Halocynthia roretzi PE=2 SV=1 3 477 0.0E+00
sp|P61620|S61A1_MOUSE Protein transport protein Sec61 subunit alpha isoform 1 OS=Mus musculus GN=Sec61a1 PE=1 SV=2 5 477 0.0E+00
sp|P61619|S61A1_HUMAN Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens GN=SEC61A1 PE=1 SV=2 5 477 0.0E+00
sp|P38377|S61A1_CANLF Protein transport protein Sec61 subunit alpha isoform 1 OS=Canis lupus familiaris GN=SEC61A1 PE=1 SV=3 5 477 0.0E+00
sp|Q8AY33|SC61A_BORSA Protein transport protein Sec61 subunit alpha OS=Boreogadus saida GN=sec61a PE=2 SV=3 3 477 0.0E+00
sp|Q9JLR1|S61A2_MOUSE Protein transport protein Sec61 subunit alpha isoform 2 OS=Mus musculus GN=Sec61a2 PE=2 SV=3 3 477 0.0E+00
sp|Q9H9S3|S61A2_HUMAN Protein transport protein Sec61 subunit alpha isoform 2 OS=Homo sapiens GN=SEC61A2 PE=2 SV=3 3 477 0.0E+00
sp|Q2KHX4|S61A2_BOVIN Protein transport protein Sec61 subunit alpha isoform 2 OS=Bos taurus GN=SEC61A2 PE=2 SV=3 3 477 0.0E+00
sp|Q5NVM7|S61A2_PONAB Protein transport protein Sec61 subunit alpha isoform 2 OS=Pongo abelii GN=SEC61A2 PE=2 SV=1 3 477 0.0E+00
sp|P78979|SC61A_YARLI Protein transport protein SEC61 subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC61 PE=3 SV=2 1 464 0.0E+00
sp|Q6BN08|SC61A_DEBHA Protein transport protein SEC61 subunit alpha OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC61 PE=3 SV=1 1 466 0.0E+00
sp|Q9P8E3|SC61A_CANAL Protein transport protein SEC61 subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC61 PE=3 SV=2 1 466 0.0E+00
sp|Q6CPY9|SC61A_KLULA Protein transport protein SEC61 subunit alpha OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC61 PE=3 SV=1 1 466 0.0E+00
sp|Q752H7|SC61A_ASHGO Protein transport protein SEC61 subunit alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC61 PE=3 SV=1 1 466 0.0E+00
sp|P32915|SC61A_YEAST Protein transport protein SEC61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC61 PE=1 SV=1 1 466 0.0E+00
sp|P38379|SC61A_PYRSA Protein transport protein Sec61 subunit alpha OS=Pyrenomonas salina PE=2 SV=1 2 459 0.0E+00
sp|Q6FRY3|SC61A_CANGA Protein transport protein SEC61 subunit alpha OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC61 PE=3 SV=1 5 466 0.0E+00
sp|P79088|SC61A_SCHPO Protein transport protein sec61 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec61 PE=2 SV=1 1 469 0.0E+00
sp|P61621|S61A1_RAT Protein transport protein Sec61 subunit alpha isoform 1 OS=Rattus norvegicus GN=Sec61a1 PE=2 SV=2 5 477 0.0E+00
sp|Q870W0|SC61A_NEUCR Protein transport protein SEC61 subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec-61 PE=3 SV=1 1 464 0.0E+00
sp|Q96TW8|SC61A_WICAO Protein transport protein SEC61 subunit alpha OS=Wickerhamomyces anomalus GN=SEC61 PE=3 SV=1 1 466 0.0E+00
sp|Q54XK2|SC61A_DICDI Protein transport protein Sec61 subunit alpha OS=Dictyostelium discoideum GN=sec61a PE=3 SV=1 3 467 0.0E+00
sp|Q8AY36|SC61A_PAGBO Protein transport protein Sec61 subunit alpha OS=Pagothenia borchgrevinki GN=sec61a PE=2 SV=3 3 477 0.0E+00
sp|Q8AY35|SC61A_NOTAN Protein transport protein Sec61 subunit alpha OS=Notothenia angustata GN=sec61a PE=2 SV=3 3 477 0.0E+00
sp|Q7T278|SC61A_HARAN Protein transport protein Sec61 subunit alpha OS=Harpagifer antarcticus GN=sec61a PE=2 SV=3 3 477 0.0E+00
sp|Q7T277|SC61A_DISMA Protein transport protein Sec61 subunit alpha OS=Dissostichus mawsoni GN=sec61a PE=2 SV=3 3 477 0.0E+00
sp|Q98SN8|S61A2_ONCMY Protein transport protein Sec61 subunit alpha isoform B OS=Oncorhynchus mykiss GN=sec61ab PE=2 SV=3 3 477 0.0E+00
sp|Q98SN9|S61A1_ONCMY Protein transport protein Sec61 subunit alpha isoform A OS=Oncorhynchus mykiss GN=sec61aa PE=2 SV=3 3 477 0.0E+00
sp|Q8AY31|SC61A_BOVVA Protein transport protein Sec61 subunit alpha OS=Bovichtus variegatus GN=sec61a PE=2 SV=3 3 477 0.0E+00
sp|Q90ZM2|S61A1_DANRE Protein transport protein Sec61 subunit alpha-like 1 OS=Danio rerio GN=sec61al1 PE=2 SV=3 5 477 0.0E+00
sp|Q90YL4|S61A2_DANRE Protein transport protein Sec61 subunit alpha-like 2 OS=Danio rerio GN=sec61al2 PE=2 SV=3 5 477 0.0E+00
sp|Q8AY34|SC61A_HEMAM Protein transport protein Sec61 subunit alpha OS=Hemitripterus americanus GN=sec61a PE=2 SV=3 3 477 0.0E+00
sp|Q5EA68|S61A1_BOVIN Protein transport protein Sec61 subunit alpha isoform 1 OS=Bos taurus GN=SEC61A1 PE=2 SV=3 3 477 0.0E+00
sp|Q5R5L5|S61A1_PONAB Protein transport protein Sec61 subunit alpha isoform 1 OS=Pongo abelii GN=SEC61A1 PE=2 SV=3 5 477 0.0E+00
sp|Q8AY32|SC61A_GADOC Protein transport protein Sec61 subunit alpha OS=Gadus ogac GN=sec61a PE=2 SV=3 3 477 0.0E+00
sp|O42965|YGMH_SCHPO Uncharacterized protein C19G7.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19G7.17 PE=4 SV=2 1 460 5.0E-92
sp|Q8U019|SECY_PYRFU Protein translocase subunit SecY OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=secY PE=1 SV=1 17 465 8.0E-85
sp|Q9V1V8|SECY_PYRAB Protein translocase subunit SecY OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=secY PE=3 SV=1 17 465 4.0E-82
sp|O59442|SECY_PYRHO Protein translocase subunit SecY OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=secY PE=3 SV=1 17 465 8.0E-82
sp|Q60175|SECY_METJA Protein translocase subunit SecY OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=secY PE=1 SV=2 12 477 2.0E-81
sp|O26134|SECY_METTH Protein translocase subunit SecY OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=secY PE=3 SV=1 11 459 3.0E-81
sp|P38353|SSH1_YEAST Sec sixty-one protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSH1 PE=1 SV=1 1 477 3.0E-76
sp|P28541|SECY_METVA Protein translocase subunit SecY OS=Methanococcus vannielii GN=secY PE=3 SV=1 10 465 4.0E-76
sp|Q9YDD0|SECY_AERPE Protein translocase subunit SecY OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=secY PE=3 SV=2 17 464 8.0E-72
sp|P49978|SECY_SULAC Protein translocase subunit SecY OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=secY PE=3 SV=1 17 460 5.0E-69
sp|Q9UX84|SECY_SULSO Protein translocase subunit SecY OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=secY PE=3 SV=1 17 464 7.0E-68
sp|O28377|SECY_ARCFU Protein translocase subunit SecY OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=secY PE=3 SV=1 10 459 1.0E-59
sp|Q9HPB1|SECY_HALSA Protein translocase subunit SecY OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=secY PE=3 SV=1 12 459 2.0E-55
sp|P28542|SECY_HALMA Protein translocase subunit SecY OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=secY PE=3 SV=2 8 459 1.0E-52
sp|Q977V3|SECY_HALVD Protein translocase subunit SecY OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=secY PE=3 SV=2 8 459 3.0E-50
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0015031 protein transport Yes
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0051641 cellular localization No
GO:0033036 macromolecule localization No
GO:0051234 establishment of localization No
GO:0071702 organic substance transport No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0071705 nitrogen compound transport No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22
2 79 101 22
3 113 135 22
4 145 167 22
5 243 265 22
6 354 376 22
7 416 435 19
8 439 461 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|114410
MSGFRFLNLVRPFLPILPEVSSPDRKVPFNQKVLWTAVTLLIFLVCSQVPLYGIMSSDSSDPLYWMRVILASNRG
TLMELGISPIVTSGMIMQLLAGANLIDVDFSLKEDRALFSGAQKLFALIISLGQATVYVLTGLYGQPKDIGAGVC
LLLIIQLVAAALIVILLDELLQKGYGLGSGISLFIATNICESIVWKAFSPTTVNIGRGPEFEGAIVALFHLLFTW
NDKGRALREAFWRERLPNVMNLIATIVIFVVVIYLQGFRIEIPVKSNRFRGQRGSYPVKLFYTSNMPIMLESALT
SNVFIVSQMLATRFPANLLVRLLGVWEPMEDSPQLRAVSGVAYYMSPPHTMKEAILDPIHTAVYILFIISACALF
SKTWIEVSGSGPRDVAKQLKDQQMVMAGHREGSMYKELKRVIPTAAAFGGAMLGLLSVAADLMGAIGSGTGILMA
VTIIYSYWEIGMRESGGPEMAALGDLL*
Coding >AgabiH97|114410
ATGAGCGGCTTCAGGTTTCTCAATCTCGTCCGTCCTTTCCTGCCAATTCTCCCTGAAGTCTCGTCTCCAGACCGC
AAGGTTCCCTTCAACCAAAAGGTGCTATGGACGGCCGTCACCCTCCTCATCTTCCTTGTCTGCTCGCAGGTGCCG
CTCTATGGTATCATGTCCTCTGATTCCTCGGACCCTCTCTATTGGATGCGTGTCATCCTCGCCTCTAATCGAGGG
ACACTGATGGAACTCGGTATCAGTCCCATTGTTACTTCAGGAATGATCATGCAGCTTCTGGCCGGTGCAAACCTC
ATCGACGTCGACTTTAGTCTCAAGGAAGATCGCGCCTTGTTCTCTGGTGCCCAGAAACTTTTCGCCCTCATTATT
TCCCTTGGTCAAGCAACTGTCTATGTCCTAACAGGTCTCTATGGTCAACCTAAGGACATTGGCGCTGGTGTCTGT
CTTCTTCTCATCATTCAACTCGTCGCCGCCGCCTTGATTGTCATCCTTCTCGACGAACTTCTTCAGAAGGGTTAT
GGTCTCGGCTCTGGTATCTCCCTCTTCATCGCTACCAACATTTGCGAATCCATTGTTTGGAAAGCTTTCTCACCA
ACCACCGTCAACATTGGTCGTGGTCCAGAATTCGAAGGCGCTATCGTCGCTCTGTTCCATTTATTGTTCACTTGG
AATGATAAAGGCCGTGCACTTCGTGAGGCTTTCTGGAGGGAGAGACTGCCTAATGTGATGAATCTCATCGCTACC
ATCGTTATTTTCGTTGTCGTCATCTACCTCCAAGGATTCAGGATTGAAATTCCCGTCAAGAGCAACAGGTTCAGG
GGACAGAGGGGAAGCTACCCAGTCAAGCTCTTCTACACTTCCAACATGCCGATCATGCTCGAGAGCGCTCTCACT
TCCAATGTCTTCATTGTTTCGCAAATGCTCGCTACTCGCTTCCCTGCTAATCTACTCGTTCGTCTCCTTGGTGTC
TGGGAGCCCATGGAAGATTCACCTCAACTTCGCGCAGTATCTGGAGTTGCTTACTATATGTCCCCCCCTCATACC
ATGAAGGAAGCCATCCTTGACCCCATTCACACTGCTGTTTACATCCTTTTCATCATATCCGCTTGCGCGCTGTTC
TCTAAGACTTGGATTGAAGTTTCTGGTTCTGGTCCCCGTGACGTTGCCAAACAGCTCAAAGATCAACAAATGGTC
ATGGCCGGCCACCGTGAGGGATCCATGTACAAGGAGCTCAAGCGTGTTATCCCCACCGCCGCCGCATTCGGTGGT
GCGATGCTTGGATTACTCTCTGTAGCCGCGGATTTGATGGGTGCTATTGGAAGTGGAACGGGTATCTTGATGGCT
GTTACCATCATCTACAGCTATTGGGAGATCGGTATGAGGGAGAGTGGTGGTCCCGAAATGGCAGCTCTTGGCGAT
CTGCTATAA
Transcript >AgabiH97|114410
ATGAGCGGCTTCAGGTTTCTCAATCTCGTCCGTCCTTTCCTGCCAATTCTCCCTGAAGTCTCGTCTCCAGACCGC
AAGGTTCCCTTCAACCAAAAGGTGCTATGGACGGCCGTCACCCTCCTCATCTTCCTTGTCTGCTCGCAGGTGCCG
CTCTATGGTATCATGTCCTCTGATTCCTCGGACCCTCTCTATTGGATGCGTGTCATCCTCGCCTCTAATCGAGGG
ACACTGATGGAACTCGGTATCAGTCCCATTGTTACTTCAGGAATGATCATGCAGCTTCTGGCCGGTGCAAACCTC
ATCGACGTCGACTTTAGTCTCAAGGAAGATCGCGCCTTGTTCTCTGGTGCCCAGAAACTTTTCGCCCTCATTATT
TCCCTTGGTCAAGCAACTGTCTATGTCCTAACAGGTCTCTATGGTCAACCTAAGGACATTGGCGCTGGTGTCTGT
CTTCTTCTCATCATTCAACTCGTCGCCGCCGCCTTGATTGTCATCCTTCTCGACGAACTTCTTCAGAAGGGTTAT
GGTCTCGGCTCTGGTATCTCCCTCTTCATCGCTACCAACATTTGCGAATCCATTGTTTGGAAAGCTTTCTCACCA
ACCACCGTCAACATTGGTCGTGGTCCAGAATTCGAAGGCGCTATCGTCGCTCTGTTCCATTTATTGTTCACTTGG
AATGATAAAGGCCGTGCACTTCGTGAGGCTTTCTGGAGGGAGAGACTGCCTAATGTGATGAATCTCATCGCTACC
ATCGTTATTTTCGTTGTCGTCATCTACCTCCAAGGATTCAGGATTGAAATTCCCGTCAAGAGCAACAGGTTCAGG
GGACAGAGGGGAAGCTACCCAGTCAAGCTCTTCTACACTTCCAACATGCCGATCATGCTCGAGAGCGCTCTCACT
TCCAATGTCTTCATTGTTTCGCAAATGCTCGCTACTCGCTTCCCTGCTAATCTACTCGTTCGTCTCCTTGGTGTC
TGGGAGCCCATGGAAGATTCACCTCAACTTCGCGCAGTATCTGGAGTTGCTTACTATATGTCCCCCCCTCATACC
ATGAAGGAAGCCATCCTTGACCCCATTCACACTGCTGTTTACATCCTTTTCATCATATCCGCTTGCGCGCTGTTC
TCTAAGACTTGGATTGAAGTTTCTGGTTCTGGTCCCCGTGACGTTGCCAAACAGCTCAAAGATCAACAAATGGTC
ATGGCCGGCCACCGTGAGGGATCCATGTACAAGGAGCTCAAGCGTGTTATCCCCACCGCCGCCGCATTCGGTGGT
GCGATGCTTGGATTACTCTCTGTAGCCGCGGATTTGATGGGTGCTATTGGAAGTGGAACGGGTATCTTGATGGCT
GTTACCATCATCTACAGCTATTGGGAGATCGGTATGAGGGAGAGTGGTGGTCCCGAAATGGCAGCTCTTGGCGAT
CTGCTATAA
Gene >AgabiH97|114410
ATGAGCGGCTGTAAGTTTCCTTCTCTTCCTGCGCGTTCTCGCCCAGCTCACAGTACTCCAGTCAGGTTTCTCAAT
CTCGTCCGTCCTTTCCTGCCAATTCTCCCTGAAGTCTCGTCTCCAGACCGCAAGGTTCGCGTTTCCAGCAGTCGT
TTCACTCATTTTACAAACGAGTTTTCCTCTAGGTTCCCTTCAACCAAAAGGTGCTATGGACGGCCGTCACCCTCC
TCATCTTCCTTGTCTGCTCGCAGGTGCCGCTCTATGGTATCATGTCCTCTGATTCCTCGGACCCTCTCTATTGGA
TGCGTGTCATCCTCGCCTCTAATCGAGGGACACTGATGGAACTCGGTATCAGTCCCATTGTTACTTCAGGAATGA
TCATGCAGCTTCTGGCCGGTGCAAACCTCATCGACGTCGACTTTAGTCTCAAGGAAGATCGCGCCTTGTTCTCTG
GTGCCCAGAAACGTTAGTACACACGACTTCTGACGTGTCACGCGAAAAGGCAACTCACCCGTCTTTTTTAGTTTT
CGCCCTCATTATTTCCCTTGGTCAAGCAACTGTCTATGTCCTAACAGGTCTCTATGGTCAACCTAAGGACATTGG
CGCTGGTGTCTGTCTTCTTCTCATCATTCAACTCGTCGCCGCCGCCTTGATTGTCATCCTTCTCGACGAACTTCT
TCAGAAGGGTTATGGTCTCGGCTCTGGTATCTCCCTCTTCATCGCTACCAACATTTGCGAATCCATTGTTTGGAA
AGCTTTCTCACCAACCACCGTCAACATTGGTCGTGGTCCAGAATTCGAAGGCGCTATCGTCGCTCTGTTCCATTT
ATTGTTCACTTGGAATGATAAAGGCCGTGCACTTCGTGAGGCTTTCTGGAGGGAGAGACTGCCTAATGTGATGAA
TCTCATCGCTACCATCGTTATTTTCGTTGTCGTCATCTACCTCCAAGGATTCAGGATTGAAATTCCCGTCAAGAG
CAACAGGTTCAGGGGACAGAGGGGAAGCTACCCAGTCAAGCTCTTCTACACTTCCAACATGCCGATCATGCTCGA
GAGCGCTCTCACTTCCAATGTCTTCATTGTTTCGCAAATGCTCGCTACTCGCTTCCCTGCTAATCTACTCGTTCG
TCTCCTTGGTGTCTGGGAGGTAAGCTCCGATAATACCAACAGTGCTGCCACATTTCTAACTTGGATTTCAGCCCA
TGGAAGATTCACCTCAACTTCGCGCAGTATCTGGAGTTGCTTACTATATGTCCCCCCCTCATACCATGAAGGAAG
CCATCCTTGACCCCATTCACACTGCTGTTTACATCCTTTTCATCATATCCGCTTGCGCGCTGTTCTCTAAGACTT
GGATTGAAGTTTCTGGTTCTGGTCCCCGTGACGTTGCCAAACAGCTCAAAGATCAACAAATGGTACATTCTTCGC
GCTTTGATCTATTTCATCTTCTCATTCATTTCTAGGTCATGGCCGGCCACCGTGAGGGATCCATGTACAAGGAGC
TCAAGCGTGTTATCCCCACCGCCGCCGCATTCGGTGGTGCGATGCTTGGATTACTCTCTGTAGCCGCGGATTTGA
TGGGTGCTATTGGAAGTGGAACGGGTATCTTGATGGCTGTTACCATCATCTACAGCTGTGAGTATTAAGGTTCTT
TGTGCAAGTGTGGATGCTCATGCCGTTGTCTATGTAGATTGGGAGATCGGTATGAGGGAGAGTGGTGGTCCCGAA
ATGGCAGCTCTTGGCGATCTGCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail