Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|114370
Gene name
Locationscaffold_9:209261..210932
Strand-
Gene length (bp)1671
Transcript length (bp)1347
Coding sequence length (bp)1347
Protein length (aa) 449

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07767 Nop53 Nop53 (60S ribosomal biogenesis) 1.3E-93 26 415

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUI4|YIY9_SCHPO Uncharacterized protein C22F8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22F8.09 PE=1 SV=1 17 447 2.0E-43
sp|Q9NZM5|GSCR2_HUMAN Glioma tumor suppressor candidate region gene 2 protein OS=Homo sapiens GN=GLTSCR2 PE=1 SV=2 32 438 2.0E-18
sp|Q9W3C2|GSCR2_DROME Uncharacterized protein CG1785 OS=Drosophila melanogaster GN=CG1785 PE=2 SV=1 214 445 8.0E-16

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|114370
MTSSLKSSEKSSKSSVGAPAQLSQASRKGKKAWRKNVDIGEVEVGLEGMRAEERVTGKTLQKAANDELFVIDTIG
DEQIRKTLPRRFSNSALTSAKILSQRSAVPAVYSRINSTNAVDREKKRKMSREEKDRLLRIAKRPKKGPFNAVMD
PSEYQAGHSVVELSGAVKESGGYDPWDSKVEDEVAEDLPKAKKVKAPATTRVRDQIAIPAVSEPHPGISYNPPVN
AHQELIAHAAAEEEKRLKEQDNLAKVKIKMEEARLENSDAIGTSRGAPGMKIDEPLDEDVKEEEADNAIVKPLSL
QRKTKAQRNREAKLLSEKHALAQKAADKRLMASLSLARGLRRSMAKSIAERELEILQKKSALKYRLKKHGLAGQR
LGKHKVPEGQVDVQLGEDLTETLRGLKPEGNLFRDRFLSLQQRAIIEPRVPVLPRKRKIRIVEYEKHAWKRFE*
Coding >AgabiH97|114370
ATGACCTCTTCACTAAAATCAAGCGAGAAATCTAGTAAATCGAGTGTGGGAGCTCCTGCACAACTTAGTCAGGCT
AGCAGGAAAGGGAAGAAGGCGTGGAGGAAAAATGTAGATATCGGAGAGGTGGAGGTGGGATTAGAGGGTATGAGG
GCTGAGGAAAGAGTGACCGGGAAAACTCTGCAAAAAGCCGCGAACGACGAGCTTTTCGTGATTGATACTATTGGC
GATGAACAAATTAGAAAAACACTTCCACGCCGATTTTCAAACTCTGCGCTCACATCGGCAAAAATCCTCTCGCAG
CGTTCTGCCGTACCTGCCGTGTATTCGCGGATTAATTCAACAAATGCTGTTGACCGAGAGAAGAAGAGGAAAATG
TCAAGAGAAGAGAAGGATCGCTTGCTTAGAATTGCGAAGAGACCGAAGAAAGGACCCTTCAATGCTGTGATGGAC
CCTTCTGAATACCAGGCCGGACATAGTGTTGTGGAGTTGAGCGGCGCGGTCAAGGAGAGTGGTGGTTATGATCCT
TGGGACAGCAAAGTTGAAGATGAAGTGGCGGAAGATTTACCGAAGGCGAAAAAAGTCAAGGCACCCGCGACGACG
CGCGTACGGGATCAAATTGCCATTCCTGCCGTATCAGAACCACACCCGGGAATATCATATAACCCGCCTGTGAAT
GCACACCAAGAACTTATCGCCCATGCAGCCGCGGAGGAAGAGAAGCGACTGAAAGAACAAGACAATCTGGCAAAG
GTCAAAATCAAGATGGAAGAGGCTCGGTTGGAAAATAGTGACGCTATTGGCACTTCCCGAGGTGCACCGGGAATG
AAGATAGACGAACCATTGGATGAAGATGTGAAGGAAGAAGAGGCGGATAATGCCATTGTGAAGCCTCTTTCACTG
CAAAGAAAGACAAAGGCACAGAGGAATAGAGAGGCCAAACTTCTTTCAGAGAAACATGCATTGGCACAAAAAGCC
GCAGATAAACGACTCATGGCTTCGCTATCACTCGCGAGAGGATTGAGACGATCCATGGCCAAATCCATAGCCGAA
CGCGAATTGGAAATATTGCAAAAAAAATCTGCCCTTAAATATCGGTTGAAAAAGCATGGACTTGCGGGCCAACGG
CTAGGCAAACACAAGGTACCCGAAGGCCAAGTCGACGTACAGTTAGGCGAAGACCTGACTGAGACCTTACGCGGA
CTCAAGCCTGAAGGAAATCTTTTCCGTGACCGATTCCTAAGCTTACAGCAGAGAGCGATCATTGAGCCTCGCGTT
CCAGTCTTACCCAGGAAACGGAAGATACGGATCGTAGAGTACGAGAAACATGCATGGAAGCGGTTTGAGTAG
Transcript >AgabiH97|114370
ATGACCTCTTCACTAAAATCAAGCGAGAAATCTAGTAAATCGAGTGTGGGAGCTCCTGCACAACTTAGTCAGGCT
AGCAGGAAAGGGAAGAAGGCGTGGAGGAAAAATGTAGATATCGGAGAGGTGGAGGTGGGATTAGAGGGTATGAGG
GCTGAGGAAAGAGTGACCGGGAAAACTCTGCAAAAAGCCGCGAACGACGAGCTTTTCGTGATTGATACTATTGGC
GATGAACAAATTAGAAAAACACTTCCACGCCGATTTTCAAACTCTGCGCTCACATCGGCAAAAATCCTCTCGCAG
CGTTCTGCCGTACCTGCCGTGTATTCGCGGATTAATTCAACAAATGCTGTTGACCGAGAGAAGAAGAGGAAAATG
TCAAGAGAAGAGAAGGATCGCTTGCTTAGAATTGCGAAGAGACCGAAGAAAGGACCCTTCAATGCTGTGATGGAC
CCTTCTGAATACCAGGCCGGACATAGTGTTGTGGAGTTGAGCGGCGCGGTCAAGGAGAGTGGTGGTTATGATCCT
TGGGACAGCAAAGTTGAAGATGAAGTGGCGGAAGATTTACCGAAGGCGAAAAAAGTCAAGGCACCCGCGACGACG
CGCGTACGGGATCAAATTGCCATTCCTGCCGTATCAGAACCACACCCGGGAATATCATATAACCCGCCTGTGAAT
GCACACCAAGAACTTATCGCCCATGCAGCCGCGGAGGAAGAGAAGCGACTGAAAGAACAAGACAATCTGGCAAAG
GTCAAAATCAAGATGGAAGAGGCTCGGTTGGAAAATAGTGACGCTATTGGCACTTCCCGAGGTGCACCGGGAATG
AAGATAGACGAACCATTGGATGAAGATGTGAAGGAAGAAGAGGCGGATAATGCCATTGTGAAGCCTCTTTCACTG
CAAAGAAAGACAAAGGCACAGAGGAATAGAGAGGCCAAACTTCTTTCAGAGAAACATGCATTGGCACAAAAAGCC
GCAGATAAACGACTCATGGCTTCGCTATCACTCGCGAGAGGATTGAGACGATCCATGGCCAAATCCATAGCCGAA
CGCGAATTGGAAATATTGCAAAAAAAATCTGCCCTTAAATATCGGTTGAAAAAGCATGGACTTGCGGGCCAACGG
CTAGGCAAACACAAGGTACCCGAAGGCCAAGTCGACGTACAGTTAGGCGAAGACCTGACTGAGACCTTACGCGGA
CTCAAGCCTGAAGGAAATCTTTTCCGTGACCGATTCCTAAGCTTACAGCAGAGAGCGATCATTGAGCCTCGCGTT
CCAGTCTTACCCAGGAAACGGAAGATACGGATCGTAGAGTACGAGAAACATGCATGGAAGCGGTTTGAGTAG
Gene >AgabiH97|114370
ATGACCTCTTCACTAAAATCAAGCGAGAAATCTAGTAAATCGAGTGTGGGAGCTCCTGCACAACTTAGTCAGGCT
AGCAGGAAAGGGAAGAAGGCGTGGAGGAAAAATGTAGATATCGGAGAGGTGGAGGTGGGATTAGAGGGTATGAGG
GCTGAGGAAAGAGTGACCGGGTGAGTGGGATTTCATATCCTTTGCTCTGACGAAGGATGCTAATACCGTTTATAG
GAAAACTCTGCAAAAAGCCGCGAACGACGAGCTTTTCGTGATTGATACTATTGGCGATGAACAAAGTACGTCTAC
AGTTTTTTTTGTTGAGAATGAAATTTGATTTCTTTTTCAAAGTTAGAAAAACACTTCCACGCCGATTTTCAAACT
CTGCGCTCACATCGGCAAAAATCCTCTCGCAGCGTTCTGCCGTACCTGCCGTGTATTCGCGGATTAATTCAACAA
ATGCTGTTGACCGAGAGAAGAAGAGGAAAATGTCAAGAGAAGAGAAGGATCGCTTGCTTAGAATTGCGAAGAGAC
CGAAGAAAGGACCCTTCAATGCTGTGATGGACCCTTCTGAATACCAGGCCGGACATAGTGTTGTGGAGTTGAGCG
GCGCGGTCAAGGAGAGTGGTGGTTATGATCCTTGGGACAGCAAAGTTGAAGATGAAGTGGCGGAAGATTTACCGA
AGGCGAAAAAAGTCAAGGTGAAAGAGTTGGACTTATCTTCGTTTTGCTAGTACTGATAGTTGTATACAGGCACCC
GCGACGACGCGCGTACGGGATCAAATTGCCATTCCTGCCGTATCAGAACCACACCCGGGAATATCATATAACCCG
CCTGTGAATGCACACCAAGAACTTATCGCCCATGCAGCCGCGGAGGAAGAGAAGCGACTGAAAGAACAAGACAAT
CTGGCAAAGGTCAAAATCAAGATGGAAGAGGCTCGGTTGGAAAATAGTGACGCTATTGGCACTTCCCGAGGTGCA
CCGGGAATGAAGATAGACGAACCATTGGATGAAGATGTGAAGGAAGAAGAGGCGGATAATGCCATTGTGAAGCCT
CTTTCACTGCAAAGAAAGACAAAGGCACAGAGGAATAGAGAGGCCAAACTTCTTTCAGAGGTATATGTCATTATA
TATTCAGTCGTGTTTGTGGATGCTGATAGTTTGGTATAGAAACATGCATTGGCACAAAAAGCCGCAGATAAACGA
CTCATGGCTTCGCTATCACTCGCGAGAGGATTGAGACGATCCATGGCCAAATCCATAGCCGAACGCGAATTGGAA
ATATTGCAAAAAAAATCTGCCCTTAAATATCGGTTGAAAAAGCATGGACTTGCGGGCCAACGGCTAGGCAAACAC
AAGGTACCCGAAGGCCAAGTCGACGTACAGTTAGGCGAAGACCTGACTGAGACCTTACGCGGACTCAAGGTGATT
GGTGCTGAGTATCTTGTTTCTGTTGAACTCTTTACTAATGATATTTCATAGCCTGAAGGAAATCTTTTCCGTGAC
CGATTCCTAAGCTTACAGCAGAGAGCGATCATTGAGCCTCGCGTTCCAGTCTTGTAAGCAGTCTCGCCGCGTCCA
CAGTTCCGTGTACTCAATGCCATGCTTTTCAGACCCAGGAAACGGAAGATACGGATCGTAGAGTACGAGAAACAT
GCATGGAAGCGGTTTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail