Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|114240
Gene name
Locationscaffold_9:175190..177792
Strand-
Gene length (bp)2602
Transcript length (bp)2235
Coding sequence length (bp)2235
Protein length (aa) 745

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00384 Molybdopterin Molybdopterin oxidoreductase 5.2E-61 309 638
PF13510 Fer2_4 2Fe-2S iron-sulfur cluster binding domain 2.0E-19 37 112
PF10588 NADH-G_4Fe-4S_3 NADH-ubiquinone oxidoreductase-G iron-sulfur binding region 3.4E-17 119 158
PF09326 NADH_dhqG_C NADH-ubiquinone oxidoreductase subunit G, C-terminal 1.6E-15 687 721
PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain 8.6E-09 41 101

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29915|NQO3_PARDE NADH-quinone oxidoreductase chain 3 OS=Paracoccus denitrificans GN=nqo3 PE=1 SV=4 40 722 0.0E+00
sp|P24918|NDUS1_NEUCR NADH-ubiquinone oxidoreductase 78 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo78 PE=1 SV=2 1 722 0.0E+00
sp|Q92G92|NUOG_RICCN NADH-quinone oxidoreductase subunit G OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nuoG PE=3 SV=2 38 722 0.0E+00
sp|Q68VV2|NUOG_RICTY NADH-quinone oxidoreductase subunit G OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoG PE=3 SV=1 38 722 0.0E+00
sp|Q9ZCF6|NUOG_RICPR NADH-quinone oxidoreductase subunit G OS=Rickettsia prowazekii (strain Madrid E) GN=nuoG PE=3 SV=1 38 722 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29915|NQO3_PARDE NADH-quinone oxidoreductase chain 3 OS=Paracoccus denitrificans GN=nqo3 PE=1 SV=4 40 722 0.0E+00
sp|P24918|NDUS1_NEUCR NADH-ubiquinone oxidoreductase 78 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo78 PE=1 SV=2 1 722 0.0E+00
sp|Q92G92|NUOG_RICCN NADH-quinone oxidoreductase subunit G OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nuoG PE=3 SV=2 38 722 0.0E+00
sp|Q68VV2|NUOG_RICTY NADH-quinone oxidoreductase subunit G OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoG PE=3 SV=1 38 722 0.0E+00
sp|Q9ZCF6|NUOG_RICPR NADH-quinone oxidoreductase subunit G OS=Rickettsia prowazekii (strain Madrid E) GN=nuoG PE=3 SV=1 38 722 0.0E+00
sp|Q4UK22|NUOG_RICFE NADH-quinone oxidoreductase subunit G OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nuoG PE=3 SV=1 38 722 0.0E+00
sp|Q1RKD2|NUOG_RICBR NADH-quinone oxidoreductase subunit G OS=Rickettsia bellii (strain RML369-C) GN=nuoG PE=3 SV=1 38 722 0.0E+00
sp|Q9FGI6|NDUS1_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 1, mitochondrial OS=Arabidopsis thaliana GN=EMB1467 PE=1 SV=2 38 727 0.0E+00
sp|O21241|NDUS1_RECAM NADH-ubiquinone oxidoreductase 75 kDa subunit OS=Reclinomonas americana GN=NAD11 PE=3 SV=1 38 722 0.0E+00
sp|Q94511|NDUS1_DROME NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Drosophila melanogaster GN=ND-75 PE=2 SV=3 38 721 0.0E+00
sp|Q0MQG1|NDUS1_GORGO NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS1 PE=2 SV=1 38 735 0.0E+00
sp|P15690|NDUS1_BOVIN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Bos taurus GN=NDUFS1 PE=1 SV=1 1 735 0.0E+00
sp|Q91VD9|NDUS1_MOUSE NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Mus musculus GN=Ndufs1 PE=1 SV=2 38 735 0.0E+00
sp|Q66HF1|NDUS1_RAT NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Rattus norvegicus GN=Ndufs1 PE=1 SV=1 38 735 0.0E+00
sp|P0CB68|NDUS1_PONPY NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pongo pygmaeus GN=NDUFS1 PE=2 SV=1 38 735 0.0E+00
sp|P28331|NDUS1_HUMAN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens GN=NDUFS1 PE=1 SV=3 38 735 0.0E+00
sp|Q43644|NDUS1_SOLTU NADH dehydrogenase [ubiquinone] iron-sulfur protein 1, mitochondrial OS=Solanum tuberosum PE=2 SV=1 38 722 0.0E+00
sp|Q4R6K9|NDUS1_MACFA NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Macaca fascicularis GN=NDUFS1 PE=2 SV=1 38 735 0.0E+00
sp|Q0MQG2|NDUS1_PANTR NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pan troglodytes GN=NDUFS1 PE=2 SV=1 38 735 0.0E+00
sp|P0CB67|NDUS1_PONAB NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pongo abelii GN=NDUFS1 PE=2 SV=1 38 735 0.0E+00
sp|Q37373|NDUS1_ACACA NADH-ubiquinone oxidoreductase 75 kDa subunit OS=Acanthamoeba castellanii GN=NAD11 PE=3 SV=1 37 728 4.0E-168
sp|Q34312|NDUS1_DICDI NADH-ubiquinone oxidoreductase 75 kDa subunit OS=Dictyostelium discoideum GN=nad11 PE=3 SV=1 54 715 2.0E-124
sp|Q2LCP5|NDUS1_DICCI NADH-ubiquinone oxidoreductase 75 kDa subunit OS=Dictyostelium citrinum GN=nad11 PE=3 SV=2 54 718 5.0E-124
sp|Q9XAR0|NUOG_STRCO NADH-quinone oxidoreductase subunit G OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nuoG PE=3 SV=1 38 656 1.0E-77
sp|Q56223|NQO3_THET8 NADH-quinone oxidoreductase subunit 3 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=nqo3 PE=1 SV=2 38 651 3.0E-69
sp|P9WIV9|NUOG_MYCTU NADH-quinone oxidoreductase subunit G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nuoG PE=1 SV=1 38 432 9.0E-65
sp|P9WIV8|NUOG_MYCTO NADH-quinone oxidoreductase subunit G OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nuoG PE=3 SV=1 38 432 9.0E-65
sp|P59962|NUOG_MYCBO NADH-quinone oxidoreductase subunit G OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nuoG PE=3 SV=1 38 432 9.0E-65
sp|P56914|NUOG2_RHIME NADH-quinone oxidoreductase subunit G 2 OS=Rhizobium meliloti (strain 1021) GN=nuoG2 PE=3 SV=2 38 341 1.0E-64
sp|Q9KGW3|NUOG_PSEFL NADH-quinone oxidoreductase subunit G OS=Pseudomonas fluorescens GN=nuoG PE=2 SV=1 39 614 3.0E-59
sp|Q8EI34|NUOG_SHEON NADH-quinone oxidoreductase subunit G OS=Shewanella oneidensis (strain MR-1) GN=nuoG PE=3 SV=1 39 636 4.0E-59
sp|Q87ZQ4|NUOG_PSESM NADH-quinone oxidoreductase subunit G OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nuoG PE=3 SV=1 39 614 8.0E-57
sp|P0A1Y4|NUOG_SALTY NADH-quinone oxidoreductase subunit G OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nuoG PE=3 SV=2 39 432 1.0E-56
sp|P0A1Y5|NUOG_SALTI NADH-quinone oxidoreductase subunit G OS=Salmonella typhi GN=nuoG PE=3 SV=2 39 432 1.0E-56
sp|Q7UC56|NUOG_SHIFL NADH-quinone oxidoreductase subunit G OS=Shigella flexneri GN=nuoG PE=3 SV=3 39 432 2.0E-56
sp|P33602|NUOG_ECOLI NADH-quinone oxidoreductase subunit G OS=Escherichia coli (strain K12) GN=nuoG PE=1 SV=4 39 432 2.0E-56
sp|Q8FFJ9|NUOG_ECOL6 NADH-quinone oxidoreductase subunit G OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nuoG PE=3 SV=3 39 432 2.0E-56
sp|Q8XCX2|NUOG_ECO57 NADH-quinone oxidoreductase subunit G OS=Escherichia coli O157:H7 GN=nuoG PE=3 SV=3 39 432 2.0E-56
sp|Q89AU1|NUOG_BUCBP NADH-quinone oxidoreductase subunit G OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nuoG PE=3 SV=1 40 432 6.0E-55
sp|D7AF63|SFRA_GEOSK NADPH-Fe(3+) oxidoreductase subunit alpha OS=Geobacter sulfurreducens (strain DL-1 / KN400) GN=sfrA PE=3 SV=1 38 432 8.0E-53
sp|Q74FU6|SFRA_GEOSL NADPH-Fe(3+) oxidoreductase subunit alpha OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=sfrA PE=1 SV=1 38 432 8.0E-53
sp|Q8ZDL2|NUOG_YERPE NADH-quinone oxidoreductase subunit G OS=Yersinia pestis GN=nuoG PE=3 SV=1 39 614 3.0E-52
sp|P57257|NUOG_BUCAI NADH-quinone oxidoreductase subunit G OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nuoG PE=3 SV=1 40 415 2.0E-51
sp|Q88FH2|NUOG_PSEPK NADH-quinone oxidoreductase subunit G OS=Pseudomonas putida (strain KT2440) GN=nuoG PE=3 SV=1 39 432 3.0E-51
sp|Q9I0J6|NUOG_PSEAE NADH-quinone oxidoreductase subunit G OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nuoG PE=3 SV=1 39 640 2.0E-50
sp|Q8K9Y2|NUOG_BUCAP NADH-quinone oxidoreductase subunit G OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nuoG PE=3 SV=1 40 424 3.0E-50
sp|Q7VRV7|NUOG_BLOFL NADH-quinone oxidoreductase subunit G OS=Blochmannia floridanus GN=nuoG PE=3 SV=1 38 432 2.0E-47
sp|Q46508|HNDD_DESFR NADP-reducing hydrogenase subunit HndC OS=Desulfovibrio fructosivorans GN=hndD PE=1 SV=1 38 247 1.0E-27
sp|Q49ZN0|FDHL_STAS1 Putative formate dehydrogenase SSP0601 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0601 PE=3 SV=1 38 431 2.0E-23
sp|Q795Y4|FDHL_BACSU Putative formate dehydrogenase YrhE OS=Bacillus subtilis (strain 168) GN=yrhE PE=3 SV=1 38 432 6.0E-21
sp|O34720|YJGC_BACSU Probable oxidoreductase YjgC OS=Bacillus subtilis (strain 168) GN=yjgC PE=3 SV=1 39 432 1.0E-20
sp|Q5HDP9|FDHL_STAAC Putative formate dehydrogenase SACOL2301 OS=Staphylococcus aureus (strain COL) GN=SACOL2301 PE=3 SV=1 38 432 5.0E-20
sp|Q2FEI5|FDHL_STAA3 Putative formate dehydrogenase SAUSA300_2258 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2258 PE=3 SV=1 38 432 5.0E-20
sp|Q2FVV9|FDHL_STAA8 Putative formate dehydrogenase SAOUHSC_02582 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02582 PE=3 SV=1 38 432 5.0E-20
sp|Q6GEC4|FDHL_STAAR Putative formate dehydrogenase SAR2393 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2393 PE=3 SV=1 38 482 6.0E-20
sp|Q931G2|FDHL_STAAM Putative formate dehydrogenase SAV2309 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2309 PE=3 SV=1 38 432 9.0E-20
sp|Q7A057|FDHL_STAAW Putative formate dehydrogenase MW2229 OS=Staphylococcus aureus (strain MW2) GN=MW2229 PE=3 SV=1 38 432 1.0E-19
sp|Q99RW4|FDHL_STAAN Putative formate dehydrogenase SA2102 OS=Staphylococcus aureus (strain N315) GN=SA2102 PE=1 SV=1 38 432 1.0E-19
sp|Q6G711|FDHL_STAAS Putative formate dehydrogenase SAS2201 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2201 PE=3 SV=1 38 432 1.0E-19
sp|Q2YYT1|FDHL_STAAB Putative formate dehydrogenase SAB2186c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2186c PE=3 SV=1 38 482 2.0E-19
sp|Q4L8G8|FDHL_STAHJ Putative formate dehydrogenase SH0748 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0748 PE=3 SV=1 38 432 1.0E-18
sp|P22318|HOXU_CUPNH NAD-reducing hydrogenase HoxS subunit gamma OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hoxU PE=1 SV=2 38 258 3.0E-18
sp|Q60314|Y006_METJA Uncharacterized oxidoreductase MJ0006 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0006 PE=3 SV=1 264 653 7.0E-17
sp|P61159|FDHA_METJA Formate dehydrogenase subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fdhA PE=3 SV=2 555 661 1.0E-12
sp|P86203|NDUS1_MESAU NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial (Fragments) OS=Mesocricetus auratus GN=NDUFS1 PE=1 SV=1 531 654 3.0E-09
sp|Q49ZN0|FDHL_STAS1 Putative formate dehydrogenase SSP0601 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0601 PE=3 SV=1 574 670 7.0E-08
sp|Q6G711|FDHL_STAAS Putative formate dehydrogenase SAS2201 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2201 PE=3 SV=1 575 735 2.0E-07
sp|Q7A057|FDHL_STAAW Putative formate dehydrogenase MW2229 OS=Staphylococcus aureus (strain MW2) GN=MW2229 PE=3 SV=1 575 735 2.0E-07
sp|Q99RW4|FDHL_STAAN Putative formate dehydrogenase SA2102 OS=Staphylococcus aureus (strain N315) GN=SA2102 PE=1 SV=1 575 735 2.0E-07
sp|Q931G2|FDHL_STAAM Putative formate dehydrogenase SAV2309 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2309 PE=3 SV=1 575 735 2.0E-07
sp|Q2YYT1|FDHL_STAAB Putative formate dehydrogenase SAB2186c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2186c PE=3 SV=1 575 661 2.0E-07
sp|Q2FEI5|FDHL_STAA3 Putative formate dehydrogenase SAUSA300_2258 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2258 PE=3 SV=1 575 735 2.0E-07
sp|Q5HDP9|FDHL_STAAC Putative formate dehydrogenase SACOL2301 OS=Staphylococcus aureus (strain COL) GN=SACOL2301 PE=3 SV=1 575 735 2.0E-07
sp|Q2FVV9|FDHL_STAA8 Putative formate dehydrogenase SAOUHSC_02582 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02582 PE=3 SV=1 575 735 2.0E-07
sp|Q4L8G8|FDHL_STAHJ Putative formate dehydrogenase SH0748 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0748 PE=3 SV=1 575 728 1.0E-06
sp|Q6GEC4|FDHL_STAAR Putative formate dehydrogenase SAR2393 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2393 PE=3 SV=1 575 661 2.0E-06
sp|P61159|FDHA_METJA Formate dehydrogenase subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fdhA PE=3 SV=2 252 432 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0016651 oxidoreductase activity, acting on NAD(P)H Yes
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0051540 metal cluster binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|114240
MLRIVSTISRPTSTGIFGKVATSGRRSLASSSSRNADITLTVDGKEVTVPQGSALIQACEAAGAAIPRFCYHDRL
AIAGNCRMCLVEVERSPKPVASCAMPAMPGSKVFTNTPLVHQAREGVMEFLLVNHPLDCPICDQGGECDLQDQAM
RYGSDRNRFHEITGKRAVENKDFGPLVKTSMNRCIQCTRCVRFANEVAGVEDLGTTGRGNDMQIGMYVEKTMKSE
LSGNVIDLCPVGALTSKPYAFQARPWELKSTESIDVTDAIGSNIRVDSRGVQVMRVQPKTNDDVNEEWISDKTRY
AYDGLRAQRLTTPLVKKGDRFVAATWEEALTAVTEGLAASGATGNQIQAVAGHLADTESLVALKDLANRLNSDNL
TLDQPGGHLPPVHGVDVRSNYLFNATIPGVEEADAILLIGTNPRHEAAVLNSRIRKSWLHSSLEIGWVGEHADTT
YGYEFLGSDAKALEAFVSGKVAESAFSKKWAEAKKPLVIVGSALSEHSDATAVYKALAKLVEKEKARLVTPEWNG
FSVLQRVASRAAAYEIGFTPSRVASQTKPKFIYLLNADEIDPKSIPSDAFVVYQGHHGDLGAQIADVCLPGSAYT
EKSTTWVNTEGRAQLGRAAVGPPGAAREDWKIVRALSEVMGVPLPYNDTMELRDRMWEISPTIVRYDVTEKTTPE
IALAGMKDVSQRTMGAKIGGAAFKRPIENFYQTDPISRASVTMAQCTREFVKGEALSSKPGQVEQAAYA*
Coding >AgabiH97|114240
ATGCTGCGTATTGTGTCTACAATATCGCGGCCCACGTCGACGGGAATTTTCGGAAAGGTTGCAACCTCTGGTCGT
CGTTCACTCGCGTCATCATCATCGAGGAATGCGGATATCACATTGACGGTTGACGGAAAGGAAGTGACAGTTCCC
CAAGGTTCTGCCTTAATTCAAGCTTGTGAAGCCGCTGGAGCTGCGATACCAAGATTTTGCTACCATGATAGGCTA
GCAATTGCAGGAAACTGTCGTATGTGCTTGGTTGAAGTTGAGAGATCGCCAAAACCTGTAGCTTCATGTGCTATG
CCCGCTATGCCCGGTTCCAAAGTTTTTACCAACACGCCTCTCGTACATCAAGCACGAGAGGGAGTGATGGAATTC
CTCCTTGTCAATCACCCTCTCGACTGTCCCATCTGTGACCAAGGTGGTGAATGCGATCTTCAAGACCAGGCCATG
CGCTACGGTTCAGACCGCAACCGTTTTCACGAAATTACTGGCAAACGCGCCGTCGAAAACAAGGACTTTGGCCCT
CTTGTCAAGACCTCAATGAATCGTTGTATTCAATGCACACGTTGCGTCCGCTTTGCCAATGAAGTTGCTGGCGTT
GAGGATCTGGGCACAACTGGTCGTGGAAATGACATGCAGATAGGAATGTATGTGGAGAAGACCATGAAATCCGAA
CTTTCCGGAAACGTTATCGACCTCTGTCCTGTTGGAGCCCTTACAAGTAAACCCTATGCTTTCCAAGCCCGTCCC
TGGGAGCTCAAGAGCACAGAGAGCATCGATGTTACGGACGCTATTGGCTCAAATATCCGCGTCGATTCTCGCGGT
GTTCAGGTTATGCGTGTACAGCCAAAAACCAATGATGATGTCAATGAGGAGTGGATTAGCGACAAGACTCGTTAC
GCTTACGACGGTCTTAGAGCGCAGCGGTTAACAACGCCTCTAGTTAAGAAAGGCGACCGATTTGTTGCCGCTACC
TGGGAGGAGGCCTTGACCGCTGTCACTGAGGGTCTTGCTGCGTCTGGTGCAACTGGCAACCAGATCCAAGCCGTT
GCTGGCCATCTTGCCGACACTGAATCCCTCGTTGCTCTCAAAGACCTTGCCAACCGCCTTAACTCAGATAATCTC
ACTTTAGACCAACCCGGCGGACACCTTCCTCCCGTACATGGTGTTGATGTTCGTTCCAACTACCTCTTCAACGCA
ACCATACCTGGTGTCGAAGAAGCTGATGCCATTCTCCTCATTGGAACTAACCCACGACATGAAGCCGCCGTCCTA
AATTCCCGCATTCGCAAAAGTTGGCTACATTCTTCCCTCGAAATTGGCTGGGTTGGTGAACACGCCGATACGACT
TACGGTTACGAGTTCCTTGGCAGTGATGCCAAAGCACTAGAAGCCTTCGTCTCTGGAAAGGTCGCTGAGAGTGCT
TTCTCAAAGAAGTGGGCGGAAGCGAAGAAACCTTTGGTGATCGTTGGTAGTGCCCTCTCAGAGCATTCTGATGCG
ACTGCAGTGTATAAGGCCCTCGCAAAGCTTGTGGAGAAAGAGAAGGCTCGCCTTGTCACGCCTGAATGGAATGGA
TTCAGCGTCCTACAACGTGTGGCTTCTCGTGCTGCTGCCTATGAAATTGGATTCACACCATCTCGCGTCGCGTCT
CAAACAAAACCCAAATTTATTTACCTCCTCAATGCCGACGAGATCGACCCGAAATCGATTCCTTCGGACGCGTTT
GTCGTATATCAAGGACACCATGGTGACCTTGGTGCTCAAATAGCAGACGTCTGCTTACCGGGATCAGCGTACACT
GAGAAATCAACGACATGGGTGAACACTGAAGGTCGTGCCCAACTGGGGCGAGCAGCTGTCGGTCCGCCTGGCGCT
GCACGCGAAGATTGGAAAATTGTTCGTGCCCTTTCGGAGGTGATGGGTGTTCCTCTTCCGTATAATGATACAATG
GAGCTGAGGGATAGAATGTGGGAGATTTCACCGACGATTGTGAGGTATGATGTGACAGAGAAAACAACACCCGAG
ATAGCGTTGGCGGGTATGAAAGATGTGTCGCAGAGGACAATGGGGGCGAAGATTGGAGGTGCCGCATTTAAGAGG
CCAATTGAAAACTTCTATCAAACAGATCCAATTTCAAGAGCATCTGTAACAATGGCGCAATGCACTCGTGAGTTC
GTGAAGGGCGAAGCTTTAAGCAGCAAGCCGGGTCAAGTTGAGCAGGCTGCGTATGCATAG
Transcript >AgabiH97|114240
ATGCTGCGTATTGTGTCTACAATATCGCGGCCCACGTCGACGGGAATTTTCGGAAAGGTTGCAACCTCTGGTCGT
CGTTCACTCGCGTCATCATCATCGAGGAATGCGGATATCACATTGACGGTTGACGGAAAGGAAGTGACAGTTCCC
CAAGGTTCTGCCTTAATTCAAGCTTGTGAAGCCGCTGGAGCTGCGATACCAAGATTTTGCTACCATGATAGGCTA
GCAATTGCAGGAAACTGTCGTATGTGCTTGGTTGAAGTTGAGAGATCGCCAAAACCTGTAGCTTCATGTGCTATG
CCCGCTATGCCCGGTTCCAAAGTTTTTACCAACACGCCTCTCGTACATCAAGCACGAGAGGGAGTGATGGAATTC
CTCCTTGTCAATCACCCTCTCGACTGTCCCATCTGTGACCAAGGTGGTGAATGCGATCTTCAAGACCAGGCCATG
CGCTACGGTTCAGACCGCAACCGTTTTCACGAAATTACTGGCAAACGCGCCGTCGAAAACAAGGACTTTGGCCCT
CTTGTCAAGACCTCAATGAATCGTTGTATTCAATGCACACGTTGCGTCCGCTTTGCCAATGAAGTTGCTGGCGTT
GAGGATCTGGGCACAACTGGTCGTGGAAATGACATGCAGATAGGAATGTATGTGGAGAAGACCATGAAATCCGAA
CTTTCCGGAAACGTTATCGACCTCTGTCCTGTTGGAGCCCTTACAAGTAAACCCTATGCTTTCCAAGCCCGTCCC
TGGGAGCTCAAGAGCACAGAGAGCATCGATGTTACGGACGCTATTGGCTCAAATATCCGCGTCGATTCTCGCGGT
GTTCAGGTTATGCGTGTACAGCCAAAAACCAATGATGATGTCAATGAGGAGTGGATTAGCGACAAGACTCGTTAC
GCTTACGACGGTCTTAGAGCGCAGCGGTTAACAACGCCTCTAGTTAAGAAAGGCGACCGATTTGTTGCCGCTACC
TGGGAGGAGGCCTTGACCGCTGTCACTGAGGGTCTTGCTGCGTCTGGTGCAACTGGCAACCAGATCCAAGCCGTT
GCTGGCCATCTTGCCGACACTGAATCCCTCGTTGCTCTCAAAGACCTTGCCAACCGCCTTAACTCAGATAATCTC
ACTTTAGACCAACCCGGCGGACACCTTCCTCCCGTACATGGTGTTGATGTTCGTTCCAACTACCTCTTCAACGCA
ACCATACCTGGTGTCGAAGAAGCTGATGCCATTCTCCTCATTGGAACTAACCCACGACATGAAGCCGCCGTCCTA
AATTCCCGCATTCGCAAAAGTTGGCTACATTCTTCCCTCGAAATTGGCTGGGTTGGTGAACACGCCGATACGACT
TACGGTTACGAGTTCCTTGGCAGTGATGCCAAAGCACTAGAAGCCTTCGTCTCTGGAAAGGTCGCTGAGAGTGCT
TTCTCAAAGAAGTGGGCGGAAGCGAAGAAACCTTTGGTGATCGTTGGTAGTGCCCTCTCAGAGCATTCTGATGCG
ACTGCAGTGTATAAGGCCCTCGCAAAGCTTGTGGAGAAAGAGAAGGCTCGCCTTGTCACGCCTGAATGGAATGGA
TTCAGCGTCCTACAACGTGTGGCTTCTCGTGCTGCTGCCTATGAAATTGGATTCACACCATCTCGCGTCGCGTCT
CAAACAAAACCCAAATTTATTTACCTCCTCAATGCCGACGAGATCGACCCGAAATCGATTCCTTCGGACGCGTTT
GTCGTATATCAAGGACACCATGGTGACCTTGGTGCTCAAATAGCAGACGTCTGCTTACCGGGATCAGCGTACACT
GAGAAATCAACGACATGGGTGAACACTGAAGGTCGTGCCCAACTGGGGCGAGCAGCTGTCGGTCCGCCTGGCGCT
GCACGCGAAGATTGGAAAATTGTTCGTGCCCTTTCGGAGGTGATGGGTGTTCCTCTTCCGTATAATGATACAATG
GAGCTGAGGGATAGAATGTGGGAGATTTCACCGACGATTGTGAGGTATGATGTGACAGAGAAAACAACACCCGAG
ATAGCGTTGGCGGGTATGAAAGATGTGTCGCAGAGGACAATGGGGGCGAAGATTGGAGGTGCCGCATTTAAGAGG
CCAATTGAAAACTTCTATCAAACAGATCCAATTTCAAGAGCATCTGTAACAATGGCGCAATGCACTCGTGAGTTC
GTGAAGGGCGAAGCTTTAAGCAGCAAGCCGGGTCAAGTTGAGCAGGCTGCGTATGCATAG
Gene >AgabiH97|114240
ATGCTGCGTATTGTGTCTACAATATCGCGGCCCACGTCGACGGGAATTTTCGGAAAGGTTGCAACCTCTGGTGGG
TGTGTACCCGGCCTCCTTAATTTTCATGTTTTGAATGCGTACAACAACAGGTCGTCGTTCACTCGCGTCATCATC
ATCGAGGAATGCGGATATCACATTGACGGTTGACGGAAAGGAAGTGACAGTTCCCCAAGGTACTTAAACTATGCT
GTTAAAACACGTACCTCTCTAATAATGATGTTTCTAAGGTTCTGCCTTAATTCAAGCTTGTGAAGCCGCTGGAGC
TGCGATACCAAGGTCTGCATTTCTCCCCTCTTTTTCGAACCCGACCGTGATTGAATCTGGATGTAGATTTTGCTA
CCATGATAGGTCTACCCTTGTCACCTTCCAGCCCTTCTAGCTCTAACGCGAAAATAGGCTAGCAATTGCAGGAAA
CTGTCGTATGTGCTTGGTTGAAGTTGAGAGATCGCCAAAACCTGTAGCTTCATGGTGCGTGCCTTGTCGTCCCTT
TCAGCGCCTATGTTAATGTTGTTCCCAGTGCTATGCCCGCTATGCCCGGTTCCAAAGTTTTTACCAACACGCCTC
TCGTACATCAAGCACGGTAGGTATTCTTGTCTGTGTTTCGTTATTTTCCAAGGTTTCTTATCTCAATATAGAGAG
GGAGTGATGGAATTCCTCCTTGTCAATCACCCTCTCGACTGTCCCATCTGTGACCAAGGTGGTGAATGCGATCTT
CAAGACCAGGCCATGCGCTACGGTTCAGACCGCAACCGTTTTCACGAAATTACTGGCAAACGCGCCGTCGAAAAC
AAGGACTTTGGCCCTCTTGTCAAGACCTCAATGAATCGTTGTATTCAATGCACACGTTGCGTCCGCTTTGCCAAT
GAAGTTGCTGGCGTTGAGGATCTGGGCACAACTGGTCGTGGAAATGACATGCAGATAGGAATGTATGTGGAGAAG
ACCATGAAATCCGAACTTTCCGGAAACGTTATCGACCTCTGTCCTGTTGGAGCCCTTACAAGTAAACCCTATGCT
TTCCAAGCCCGTCCCTGGGAGCTCAAGAGCACAGAGAGCATCGATGTTACGGACGCTATTGGCTCAAATATCCGC
GTCGATTCTCGCGGTGTTCAGGTTATGCGTGTACAGCCAAAAACCAATGATGATGTCAATGAGGAGTGGATTAGC
GACAAGACTCGTTACGCTTACGACGGTCTTAGAGCGCAGCGGTTAACAACGCCTCTAGTTAAGAAAGGCGACCGA
TTTGTTGCCGCTACCTGGGAGGAGGCCTTGACCGCTGTCACTGAGGGTCTTGCTGCGTCTGGTGCAACTGGCAAC
CAGATCCAAGCCGTTGCTGGCCATCTTGCCGACACTGAATCCCTCGTTGCTCTCAAAGACCTTGCCAACCGCCTT
AACTCAGATAATCTCACTTTAGACCAACCCGGCGGACACCTTCCTCCCGTACATGGTGTTGATGTTCGTTCCAAC
TACCTCTTCAACGCAACCATACCTGGTGTCGAAGAAGCTGATGCCATTCTCCTCATTGGAACTAACCCACGACAT
GAAGCCGCCGTCCTAAATTCCCGCATTCGCAAAAGTTGGCTACATTCTTCCCTCGAAATTGGCTGGGTTGGTGAA
CACGCCGATACGACTTACGGTTACGAGTTCCTTGGCAGTGATGCCAAAGCACTAGAAGCCTTCGTCTCTGGAAAG
GTCGCTGAGAGTGCTTTCTCAAAGAAGTGGGCGGAAGCGAAGAAACCTTTGGTGATCGTTGGTAGTGCCCTCTCA
GAGCATTCTGATGCGACTGCAGTGTATAAGGCCCTCGCAAAGCTTGTGGAGAAAGAGAAGGCTCGCCTTGTCACG
CCTGAATGGAATGGATTCAGCGTCCTACAACGTGTGGCTTCTCGTGCTGCTGCCTATGAAATTGGATTCACACCA
TCTCGCGTCGCGTCTCAAACAAAACCCAAATTTATTTACCTCCTCAATGCCGACGAGATCGACCCGAAATCGATT
CCTTCGGACGCGTTTGTCGTATATCAAGGACACCATGGTGACCTTGGTGCTCAAATAGCAGACGTCTGCTTACCG
GGATCAGCGTACACTGAGAAATCAACGACATGGGTGAACACTGAAGGTCGTGCCCAACTGGGGCGAGCAGCTGTC
GGTCCGCCTGGCGCTGCACGCGAAGATTGGAAAATTGTTCGTGCCCTTTCGGAGGTGATGGGTGTTCCTCTTCCG
TATAATGATACAATGGAGCTGAGGGATAGAATGTGGGAGATTTCACCGACGATTGTGAGGTATGATGTGACAGAG
AAAACAACACCCGAGATAGCGTTGGCGGGTATGAAAGATGTGTCGCAGAGGACAATGGGGGCGAAGATTGGAGGT
GCCGCATTTAAGAGGCCAATTGAAAACTTCTATCAAACAGATCCAATTTCAAGAGCGTAAGTTTCTCCGTCCGCC
TTTTTCGCCAGAGGTGCTTATAATTTTTTATAGATCTGTAACAATGGCGCAATGCACTCGTGAGTTCGTGAAGGG
CGAAGCTTTAAGCAGCAAGCCGGGTCAAGTTGAGCAGGCTGCGTATGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail