Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|113980
Gene name
Locationscaffold_9:101129..103430
Strand+
Gene length (bp)2301
Transcript length (bp)1566
Coding sequence length (bp)1566
Protein length (aa) 522

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.0E-33 87 462

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 2 511 5.0E-73
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 42 520 8.0E-69
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 20 513 5.0E-66
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 4 510 1.0E-64
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 29 513 4.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 2 511 5.0E-73
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 42 520 8.0E-69
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 20 513 5.0E-66
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 4 510 1.0E-64
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 29 513 4.0E-63
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 53 511 4.0E-59
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 54 514 6.0E-59
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 65 511 6.0E-59
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 18 511 1.0E-57
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 49 511 2.0E-57
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 29 507 6.0E-57
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 21 513 2.0E-56
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 20 507 2.0E-56
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 67 518 2.0E-55
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 54 513 2.0E-55
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 20 515 6.0E-54
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 27 513 2.0E-52
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 41 513 3.0E-50
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 20 516 1.0E-48
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 67 513 8.0E-48
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 67 513 3.0E-47
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 51 510 2.0E-46
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 66 514 2.0E-45
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 66 514 2.0E-45
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 2 513 6.0E-45
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 5 517 3.0E-40
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 67 514 3.0E-37
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 2 520 2.0E-33
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 73 281 5.0E-18
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 26 266 2.0E-13
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 26 507 2.0E-11
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 370 513 3.0E-11
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 110 501 9.0E-11
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 7 507 1.0E-10
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 4 289 1.0E-10
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 122 261 4.0E-09
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 100 262 8.0E-09
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 100 262 8.0E-09
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 100 262 8.0E-09
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 100 262 9.0E-09
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 100 262 9.0E-09
sp|B7UMH7|MDTL_ECO27 Multidrug resistance protein MdtL OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtL PE=3 SV=1 100 262 1.0E-08
sp|Q0TAZ8|MDTL_ECOL5 Multidrug resistance protein MdtL OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtL PE=3 SV=1 100 262 1.0E-08
sp|B1LL36|MDTL_ECOSM Multidrug resistance protein MdtL OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtL PE=3 SV=1 100 262 1.0E-08
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 100 262 1.0E-08
sp|B7NR12|MDTL_ECO7I Multidrug resistance protein MdtL OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtL PE=3 SV=1 100 262 1.0E-08
sp|B7NF27|MDTL_ECOLU Multidrug resistance protein MdtL OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtL PE=3 SV=1 100 262 1.0E-08
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 27 518 3.0E-08
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 100 262 6.0E-08
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 100 262 6.0E-08
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 100 262 7.0E-08
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 135 260 8.0E-08
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 100 262 1.0E-07
sp|Q87FV4|MDTL_VIBPA Multidrug resistance protein MdtL OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mdtL PE=3 SV=1 95 283 2.0E-07
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 100 262 2.0E-07
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 372 503 2.0E-07
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 100 262 2.0E-07
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 100 262 3.0E-07
sp|A0L190|MDTL_SHESA Multidrug resistance protein MdtL OS=Shewanella sp. (strain ANA-3) GN=mdtL PE=3 SV=1 84 263 8.0E-07
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 91 272 1.0E-06
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 69 283 1.0E-06
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 81 236 2.0E-06
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 81 236 2.0E-06
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 100 262 2.0E-06
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 100 262 2.0E-06
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 100 262 3.0E-06
sp|Q8Z2N9|MDTL_SALTI Multidrug resistance protein MdtL OS=Salmonella typhi GN=mdtL PE=3 SV=1 100 262 3.0E-06
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 100 264 3.0E-06
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 100 262 3.0E-06
sp|A9MJT5|MDTL_SALAR Multidrug resistance protein MdtL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtL PE=3 SV=1 100 262 3.0E-06
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 100 262 3.0E-06
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 100 262 4.0E-06
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 100 262 4.0E-06
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 88 226 5.0E-06
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 80 281 6.0E-06
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 100 262 7.0E-06
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 100 262 7.0E-06
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 100 264 8.0E-06
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 100 262 9.0E-06
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 100 262 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 118 140 22
3 147 169 22
4 179 201 22
5 206 228 22
6 238 257 19
7 312 334 22
8 344 366 22
9 387 409 22
10 414 436 22
11 443 465 22
12 480 502 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|113980
MDQHSNDLPHADEEMGMAGNELNKVELPDTTTSLVKSSDSAEKFSDPKGGEPSDKDDVIWVDFEPNDPRNPINFP
RREKWLLTIVACLATVLASTAASAYNLGFESMIRDLNCTQFQATIGLSVYPLGFAVVPMFTASLSEEVGRRPLYL
WTALGYELAFVMIALAPNIQTVIVGRFLQGAFASTGATMVGGTIADVWPVAERGLPMSIFALAATFSLGLGPIIG
GWIEMNPSLGWKWINWVQMTWSGAFIPAAYFVLKETRSTIVLEKIVKQMRKKTRDQRYRARVEKPELLKLMWISC
TRPTRLVLTEPVVTSFSLWIGFLWGVLFCLLESISGVFKTLHNFNVGQTGTVFVTMCIGPLLGFATNLYQEKLYK
KYYPTRNAEARLIASCYAAFLLPIGMFIYAWCSFPKVHWISLCIAITIYMWGTFVVYLCIFSYLADCYGPYASSA
LAGQSLARNILATVFPLFTQQMYQKLTYKWANTLFGFLALIMVPIPFVLFYYGPKIRMMSKFSRMAVESQK*
Coding >AgabiH97|113980
ATGGACCAACATTCCAACGACCTCCCCCATGCCGATGAAGAGATGGGCATGGCGGGGAATGAACTGAATAAGGTC
GAGTTACCTGATACCACTACATCGCTAGTCAAGTCTTCAGATTCAGCTGAGAAATTTTCGGATCCAAAAGGGGGA
GAGCCGAGTGATAAAGACGATGTCATATGGGTTGACTTCGAGCCTAATGACCCAAGAAACCCAATTAATTTTCCT
CGACGAGAGAAATGGTTGCTCACCATCGTCGCCTGCTTAGCAACGGTGCTTGCTTCGACGGCTGCTTCCGCGTAC
AATCTCGGCTTCGAATCTATGATACGTGATCTCAACTGCACACAATTTCAAGCTACTATCGGCCTCAGCGTGTAT
CCCCTCGGTTTCGCAGTCGTACCCATGTTTACTGCGTCGCTCAGTGAAGAAGTAGGTAGAAGGCCACTATACCTG
TGGACGGCACTCGGATACGAACTTGCCTTTGTGATGATCGCATTGGCGCCCAATATCCAAACCGTTATCGTTGGG
AGATTTTTACAAGGTGCATTCGCTTCAACAGGAGCGACAATGGTTGGAGGCACGATAGCTGATGTTTGGCCCGTT
GCCGAACGCGGTCTTCCTATGTCTATTTTCGCGCTAGCAGCAACTTTTTCTCTGGGTTTGGGTCCTATCATTGGG
GGATGGATAGAGATGAATCCTAGCCTTGGGTGGAAGTGGATAAACTGGGTGCAAATGACGTGGTCGGGTGCCTTT
ATCCCCGCGGCTTACTTCGTTCTCAAAGAAACGCGATCAACAATAGTCTTAGAGAAAATCGTTAAACAGATGAGG
AAGAAGACACGAGACCAGAGATATAGAGCTCGTGTGGAGAAGCCTGAATTGCTCAAATTAATGTGGATAAGTTGT
ACTCGACCTACACGCCTGGTGTTGACCGAACCTGTTGTAACGAGTTTCAGCTTATGGATCGGTTTTCTCTGGGGG
GTCCTTTTCTGTCTTTTAGAATCGATATCTGGAGTATTCAAAACCTTGCATAATTTCAACGTTGGTCAGACAGGA
ACAGTGTTTGTCACAATGTGTATCGGTCCGCTTCTTGGATTCGCCACAAATTTATACCAGGAGAAGCTTTATAAG
AAATATTACCCAACCCGTAATGCGGAAGCTCGTTTGATTGCTTCATGCTACGCTGCCTTCCTTTTACCTATTGGA
ATGTTCATCTACGCATGGTGTTCGTTCCCCAAAGTACATTGGATATCACTCTGCATCGCCATCACAATATATATG
TGGGGCACATTCGTTGTATACCTCTGCATTTTCTCATATCTAGCGGACTGTTATGGACCTTACGCCTCTTCGGCG
CTAGCAGGACAGTCCTTGGCACGTAACATCCTCGCGACAGTGTTCCCACTCTTCACACAACAAATGTATCAAAAA
CTGACTTATAAGTGGGCCAATACCCTGTTCGGATTCCTTGCCCTAATTATGGTACCCATTCCCTTCGTATTATTT
TATTACGGACCGAAGATCAGAATGATGAGCAAGTTTTCGAGGATGGCTGTGGAGTCTCAAAAATAA
Transcript >AgabiH97|113980
ATGGACCAACATTCCAACGACCTCCCCCATGCCGATGAAGAGATGGGCATGGCGGGGAATGAACTGAATAAGGTC
GAGTTACCTGATACCACTACATCGCTAGTCAAGTCTTCAGATTCAGCTGAGAAATTTTCGGATCCAAAAGGGGGA
GAGCCGAGTGATAAAGACGATGTCATATGGGTTGACTTCGAGCCTAATGACCCAAGAAACCCAATTAATTTTCCT
CGACGAGAGAAATGGTTGCTCACCATCGTCGCCTGCTTAGCAACGGTGCTTGCTTCGACGGCTGCTTCCGCGTAC
AATCTCGGCTTCGAATCTATGATACGTGATCTCAACTGCACACAATTTCAAGCTACTATCGGCCTCAGCGTGTAT
CCCCTCGGTTTCGCAGTCGTACCCATGTTTACTGCGTCGCTCAGTGAAGAAGTAGGTAGAAGGCCACTATACCTG
TGGACGGCACTCGGATACGAACTTGCCTTTGTGATGATCGCATTGGCGCCCAATATCCAAACCGTTATCGTTGGG
AGATTTTTACAAGGTGCATTCGCTTCAACAGGAGCGACAATGGTTGGAGGCACGATAGCTGATGTTTGGCCCGTT
GCCGAACGCGGTCTTCCTATGTCTATTTTCGCGCTAGCAGCAACTTTTTCTCTGGGTTTGGGTCCTATCATTGGG
GGATGGATAGAGATGAATCCTAGCCTTGGGTGGAAGTGGATAAACTGGGTGCAAATGACGTGGTCGGGTGCCTTT
ATCCCCGCGGCTTACTTCGTTCTCAAAGAAACGCGATCAACAATAGTCTTAGAGAAAATCGTTAAACAGATGAGG
AAGAAGACACGAGACCAGAGATATAGAGCTCGTGTGGAGAAGCCTGAATTGCTCAAATTAATGTGGATAAGTTGT
ACTCGACCTACACGCCTGGTGTTGACCGAACCTGTTGTAACGAGTTTCAGCTTATGGATCGGTTTTCTCTGGGGG
GTCCTTTTCTGTCTTTTAGAATCGATATCTGGAGTATTCAAAACCTTGCATAATTTCAACGTTGGTCAGACAGGA
ACAGTGTTTGTCACAATGTGTATCGGTCCGCTTCTTGGATTCGCCACAAATTTATACCAGGAGAAGCTTTATAAG
AAATATTACCCAACCCGTAATGCGGAAGCTCGTTTGATTGCTTCATGCTACGCTGCCTTCCTTTTACCTATTGGA
ATGTTCATCTACGCATGGTGTTCGTTCCCCAAAGTACATTGGATATCACTCTGCATCGCCATCACAATATATATG
TGGGGCACATTCGTTGTATACCTCTGCATTTTCTCATATCTAGCGGACTGTTATGGACCTTACGCCTCTTCGGCG
CTAGCAGGACAGTCCTTGGCACGTAACATCCTCGCGACAGTGTTCCCACTCTTCACACAACAAATGTATCAAAAA
CTGACTTATAAGTGGGCCAATACCCTGTTCGGATTCCTTGCCCTAATTATGGTACCCATTCCCTTCGTATTATTT
TATTACGGACCGAAGATCAGAATGATGAGCAAGTTTTCGAGGATGGCTGTGGAGTCTCAAAAATAA
Gene >AgabiH97|113980
ATGGACCAACATTCCAACGACCTCCCCCATGCCGATGAAGAGATGGGCATGGCGGGGAATGAACTGAATAAGGTC
GAGTTACCTGATACCACTACATCGCTAGTCAAGTCTTCAGAGTAAGCATCTATATCCGTGAAATTTAACTCTCAC
TCTGATGAATGGACCACCAGTTCAGCTGAGAAATTTTCGGATCCAAAAGGGGGAGAGCCGAGTGATAAAGACGAT
GTCATATGGGTCGGAAATTGGCTTCTACTCCGGCTGGATTCTTTACTCACGCTTCAGGTTATACTCTAGGTTGAC
TTCGAGCCTAATGACCCAAGAAACCCAATTAATTTTCCTCGACGAGAGAAATGGTTGCTCACCATCGTCGCCTGC
TTAGCAACGGTGCTTGCTTGTGAGTTATCTGCTTAACACTGTTCATAGCTTACCTATCAACTGCTACTAATCCGA
ATATTCAGCGACGGCTGCTTCCGCGTACAATCTCGGCTTCGAATCTATGATACGTGATCTCAACTGCACACAATT
TCAAGCTACTATCGGCCTCAGCGTGTATCCCCTCGGTTTCGCAGTCGTACCCATGTTTACTGCGTCGCTCAGTGA
AGAAGTAGGTAGAAGGCCACTATACCTGTGGACGGCACTCGGATACGAACTTGCCTTTGTGATGATCGCATTGTA
CGTGCGCTTGTGTTTCTGTGTTGATAGATAATAATGTCTATTCATCTTAAGGGCGCCCAATATCCAAACCGTTAT
CGTTGGGAGATTTTTACAAGGTGCATTCGCTTCAACAGGAGCGACAATGGTTGGAGGCACGATAGCTGATGTTTG
GCCCGTTGCCGAGTACGTCCAATTTTTGCAGATTCTAGACGATTCCTGATAATAAAACGACAGACGCGGTCTTCC
TATGTCTATTTTCGCGCTAGCAGCAACTTTTTCTCTGGGTTTGGGTCCTATCATTGGGGGATGGATAGAGATGAA
TCCTAGCCTTGGGTGGAAGTGGATAAACTGGGTGCAAATGACGTGGGCCATTCCTCATTTATTAAAATTTCCAAG
GTGTCCTTAATTAATGGTGTCTTGCTGACATTAGGTGGTCGGGTGCCTTTATCCCCGCGGCTTACTTCGTTCTCA
AAGAAACGCGATCAACAATAGTCTTAGAGAAAATCGTTAAACAGATGAGGAAGAAGACACGAGACCAGAGATATA
GAGCTCGTGTGGAGAAGCCTGAATTGCTCAAATTAATGTGGATAAGTTGTACTCGACCTACACGTGAATACTTTC
CTTCACACCTTGCTCGTTCACTGCTAACGTTCTAATCGCAGGCCTGGTGTTGACCGAACCTGTTGTAACGAGTTT
CAGCGTGGGTATCAAACCTGCTTGGAGAAGAAAAGATCCTTTAATCCTCTGTTTATTTTAGTTATGGATCGGTTT
TCTCTGGGGGGTCCTTTTCTGTCTTTTAGAATCGATATCTGGAGTATTCAAAACCTTGCATAATTTCAACGTTGG
TCAGACAGGAACAGTGTTTGTCACAATGTGGTATGTGTTCAATCGAACTTAGTTTATCTCTGCTCACACCTTTCT
AGTATCGGTCCGCTTCTTGGATTCGCCACAAATTTATACCAGGAGAAGCTTTATAAGTAGGTTACAAACCCACTG
AAGATGTCTAGTCTGCTTGCTTATACCCGTGAAATAGGAAATATTACCCAACCCGTAATGCGGAAGCTCGTTTGA
TTGCTTCATGCTACGCTGCCTTCCTTTTACCTATTGGAATGTTCATCTACGCATGGTGTTCGTTCCCCAAAGTAC
ATTGGATATCACTCTGCATCGCCATCACAGTATGTGTCATTCTTCTCTACTCCATCCCAGAAGTTGACTAAGCTC
TGTTCATATTAGATATATATGTGGGGCACATTCGTTGTATACCTCTGCATTTTCTCATATCTAGCGGACTGGTAC
GTTTTCAAGAACTTTCTTTATTCCAATCATCGGCTAAGGCATGCACCTGGTAAAGTTATGGACCTTACGCCTCTT
CGGCGCTAGCAGGACAGTCCTTGGCACGTAACATCCTCGCGACAGTGTTCCCACTCTTCACACAACAAATGTATC
AAAAACTGACTTATAAGTGGGCCAATACCCTGTTCGGATTCCTTGCCCTAATTATGGTACCCATTCCCTTCGTAA
GTGCTTTCGTCCGGTGTTTCATATTGAGCTAATCTGAGCTTTGTATTTCAGGTATTATTTTATTACGGACCGAAG
ATCAGAATGATGAGCAAGTTTTCGAGGATGGCTGTGGAGTCTCAAAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail