Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|113900
Gene name
Locationscaffold_9:77410..78796
Strand-
Gene length (bp)1386
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 6.2E-14 7 127
PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain 4.1E-14 158 362

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q04869|YM94_YEAST Uncharacterized protein YMR315W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR315W PE=1 SV=1 6 371 3.0E-25
sp|O13991|YEG9_SCHPO Uncharacterized oxidoreductase C26H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.09c PE=2 SV=3 8 220 1.0E-13
sp|O42896|YBQ3_SCHPO Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC115.03 PE=3 SV=1 8 172 8.0E-11
sp|Q07982|GFO_ZYMMO Glucose--fructose oxidoreductase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gfo PE=1 SV=2 6 237 9.0E-10
sp|P40332|IOLX_BACSU scyllo-inositol 2-dehydrogenase (NAD(+)) OS=Bacillus subtilis (strain 168) GN=iolX PE=1 SV=2 25 297 3.0E-06

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|113900
MSGISGVAILGAGIFAKEAHLPALAALGASAPPLKAVYSRSEKSAKDLAQTAATILKLSSPPSVYFDNDSSSNLD
VLLARSDISSVIVILPITTQPAIVLKALAAGKHVISEKPVAADVQSGLKLIADYNSNFKSKNLIWRVAENFEAEP
GYQAAAAAIRAGKIGQVHSFKAEKIDYIDTETKWYKTPWRTIPDYQGGFLLDGGVHTIAALRVMLPHPLTHVSGF
ASLNKAYLAPHDTIHAIVQAGPGVSGVADLIFASPTKSRPAGSEFAILGTNGWLSVNHVSKPGVSGSVIRVIIHS
IVRSKDGTEVEEEEIIDEPGIGVQAELASFFAAISGKDDGKGLGDPLAALGDVAFIQAALNSGGNLVDLTQLLRG
D*
Coding >AgabiH97|113900
ATGTCAGGAATTTCTGGTGTTGCGATTCTTGGTGCTGGTATTTTTGCAAAGGAAGCCCATCTACCTGCGCTTGCT
GCTCTCGGGGCCTCTGCGCCACCTCTCAAGGCTGTTTATTCACGATCTGAGAAAAGTGCCAAGGATCTCGCTCAA
ACAGCTGCCACTATCCTGAAACTGTCATCCCCACCATCTGTCTATTTCGATAATGACAGCTCGAGCAATCTCGAC
GTTCTCCTCGCGCGAAGCGACATCTCATCAGTTATCGTAATCCTACCCATCACAACTCAGCCCGCGATCGTTCTC
AAAGCCTTAGCCGCCGGTAAACATGTCATCAGCGAAAAGCCCGTAGCTGCAGATGTTCAATCTGGGTTGAAACTG
ATCGCCGATTACAATTCTAATTTCAAGTCGAAAAATCTGATCTGGCGTGTTGCGGAGAATTTCGAAGCTGAGCCT
GGATATCAAGCGGCTGCTGCAGCTATCCGAGCTGGAAAAATTGGTCAAGTGCATTCCTTCAAGGCGGAAAAAATA
GACTATATCGATACCGAAACGAAGTGGTACAAGACTCCCTGGCGCACTATCCCTGATTATCAAGGCGGTTTCTTG
CTCGACGGCGGAGTTCATACCATTGCCGCACTTCGCGTCATGCTTCCCCACCCTCTGACGCATGTTTCCGGATTC
GCTTCCCTGAACAAGGCATATCTCGCTCCCCATGATACCATTCATGCCATTGTTCAAGCAGGTCCAGGTGTTTCT
GGGGTCGCCGATTTGATATTTGCTTCTCCTACGAAATCCCGCCCTGCAGGCAGTGAATTTGCGATTTTGGGTACC
AATGGTTGGTTGTCCGTCAACCACGTCTCTAAGCCAGGAGTTTCCGGGTCTGTTATCCGCGTCATCATTCACTCG
ATTGTAAGGTCAAAGGATGGTACGGAAGTCGAGGAGGAAGAGATTATAGATGAGCCTGGGATTGGTGTTCAGGCA
GAGTTGGCCAGCTTCTTTGCTGCTATTAGTGGTAAAGACGATGGTAAAGGTTTGGGAGACCCTCTCGCCGCGCTT
GGTGACGTTGCTTTTATACAAGCTGCGTTGAATAGCGGGGGCAATCTCGTCGACCTGACCCAGCTGCTGCGGGGT
GACTAA
Transcript >AgabiH97|113900
ATGTCAGGAATTTCTGGTGTTGCGATTCTTGGTGCTGGTATTTTTGCAAAGGAAGCCCATCTACCTGCGCTTGCT
GCTCTCGGGGCCTCTGCGCCACCTCTCAAGGCTGTTTATTCACGATCTGAGAAAAGTGCCAAGGATCTCGCTCAA
ACAGCTGCCACTATCCTGAAACTGTCATCCCCACCATCTGTCTATTTCGATAATGACAGCTCGAGCAATCTCGAC
GTTCTCCTCGCGCGAAGCGACATCTCATCAGTTATCGTAATCCTACCCATCACAACTCAGCCCGCGATCGTTCTC
AAAGCCTTAGCCGCCGGTAAACATGTCATCAGCGAAAAGCCCGTAGCTGCAGATGTTCAATCTGGGTTGAAACTG
ATCGCCGATTACAATTCTAATTTCAAGTCGAAAAATCTGATCTGGCGTGTTGCGGAGAATTTCGAAGCTGAGCCT
GGATATCAAGCGGCTGCTGCAGCTATCCGAGCTGGAAAAATTGGTCAAGTGCATTCCTTCAAGGCGGAAAAAATA
GACTATATCGATACCGAAACGAAGTGGTACAAGACTCCCTGGCGCACTATCCCTGATTATCAAGGCGGTTTCTTG
CTCGACGGCGGAGTTCATACCATTGCCGCACTTCGCGTCATGCTTCCCCACCCTCTGACGCATGTTTCCGGATTC
GCTTCCCTGAACAAGGCATATCTCGCTCCCCATGATACCATTCATGCCATTGTTCAAGCAGGTCCAGGTGTTTCT
GGGGTCGCCGATTTGATATTTGCTTCTCCTACGAAATCCCGCCCTGCAGGCAGTGAATTTGCGATTTTGGGTACC
AATGGTTGGTTGTCCGTCAACCACGTCTCTAAGCCAGGAGTTTCCGGGTCTGTTATCCGCGTCATCATTCACTCG
ATTGTAAGGTCAAAGGATGGTACGGAAGTCGAGGAGGAAGAGATTATAGATGAGCCTGGGATTGGTGTTCAGGCA
GAGTTGGCCAGCTTCTTTGCTGCTATTAGTGGTAAAGACGATGGTAAAGGTTTGGGAGACCCTCTCGCCGCGCTT
GGTGACGTTGCTTTTATACAAGCTGCGTTGAATAGCGGGGGCAATCTCGTCGACCTGACCCAGCTGCTGCGGGGT
GACTAA
Gene >AgabiH97|113900
ATGTCAGGAATTTCTGGTGTTGCGATTCTTGGTGCTGGTATTTTTGCAAAGGAAGGCAAATATTGATATGCATTA
TTCTTTGTGTGTTGATGGTGTCTGATTATTAACCACCCCTGTTCATTTTTCAACAGCCCATCTACCTGCGCTTGC
TGCTCTCGGGGCCTCTGCGCCACCTCTCAAGGCTGTTTATTCACGATCTGAGAAAAGTGCCAAGGATCTCGCTCA
AACAGCTGCCACTATCCTGAAACTGTCATCCCCACCATCTGTCTATTTCGATAATGACAGCTCGAGCAATCTCGA
CGTTCTCCTCGCGCGAAGCGACATCTCATCAGTTATCGTAATCCTACCCATCACAACTCAGCCCGCGATCGTTCT
CAAAGCCTTAGCCGCCGGTAAACATGTCATCAGCGAAAAGCCCGTAGCTGCAGATGTTCAATCTGGGTTGAAACT
GATCGCCGATTACAATTCTAATTTCAAGTCGAAAAATCTGATCTGGCGTGTTGCGGAGAATTTCGAAGCTGAGCC
TGGATATCAAGCGGCTGCTGCAGCTATCCGAGCTGGAAAAATTGGTCAAGTGCATTCCTTCAAGGCGGAAAAAAT
AGACTATATCGATACCGAAACGAAGTGGTACAAGACTCCCTGGCGCACTATCCCTGATGTGAGTACTGCCATGGA
GCCACAGTTGTGCAATCATTGATCCACTCACTTATTTGTTGTAGTATCAAGGCGGTTTCTTGGTATGTTTGAAAC
CTATCTTTACCATCATATGACATCGGTCTTATTGATCCCTTAACGTCTCTAGCTCGACGGCGGAGTTGTAAGCTT
CTAATTCATGTTCTGAGCTTCCTGTTCCCTGATATCGTCCGATAGCATACCATTGCCGCACTTCGCGTCATGCTT
CCCCACCCTCTGACGCATGTTTCCGGATTCGCTTCCCTGAACAAGGCATATCTCGCTCCCCATGATACCATTCAT
GCCATTGTTCAAGCAGGTCCAGGTGTTTCTGGGGTCGCCGATTTGATATTTGCTTCTCCTACGAAATCCCGCCCT
GCAGGCAGTGAATTTGCGATTTTGGGTACCAATGGTTGGTTGTCCGTCAACCACGTCTCTAAGCCAGGAGTTTCC
GGGTCTGTTATCCGCGTCATCATTCACTCGATTGTAAGGTCAAAGGATGGTACGGAAGTCGAGGAGGAAGAGATT
ATAGATGAGCCTGGGATTGGTGTTCAGGCAGAGTTGGCCAGCTTCTTTGCTGCTATTAGTGGTAAAGACGATGGT
AAAGGTTTGGGAGACCCTCTCGCCGCGCTTGGTGACGTTGCTTTTATACAAGCTGCGTTGAATAGCGGGGGCAAT
CTCGTCGACCTGACCCAGCTGCTGCGGGGTGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail