Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|113800
Gene name
Locationscaffold_9:42817..44799
Strand-
Gene length (bp)1982
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12051 DUF3533 Protein of unknown function (DUF3533) 1.4E-84 76 440

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P46950|SNG1_YEAST Nitrosoguanidine resistance protein SNG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNG1 PE=1 SV=1 152 439 6.0E-23
sp|P47090|YJY5_YEAST Uncharacterized endoplasmic reticulum membrane protein YJR015W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR015W PE=1 SV=1 9 453 1.0E-16

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 263 285 22
3 305 327 22
4 347 369 22
5 376 398 22
6 427 449 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|113800
MASANSSYDDVRSQIIELEGQKMLKTVPSVEDSSVPRQTTCNAISKPTLYHNSFFSSEAPMAAARKQYLKIMFGG
VVVLTLVIFMIFSILWGAYFRTPSYNLTGWIIDFDGSTVGQAVVDGLTQPGIPSKIDWSVLQAEQFPDGIVGVSH
AVAEHQTWVAVTVNSGASDRLTTSINSPNATYDGSEAISVFTVEARNENAFRIIIRPSVETILSMISARFGLQVA
RSLSDSPAVSQLLATSPQTVTTPISYQLVNLRPFSQPLASLVIFTGLIFMIILTFFIAVIGNGAREATNIHRLLR
YRSLLALRFTTIFTAYFFLSLFYSLLSLAFQLDVNEKFGKSSFLVLWMMDYTGMLALGLALESMLTLVGIKFLPM
FLLLWIMSNVSVVAFPIEVLPIIYRYGYAAPCYCISKIARTIIFGTKNQVGYYFGILIAWVAISCLTLTLFQFLA
RRRDVRANQQGPPPTEKVEA*
Coding >AgabiH97|113800
ATGGCCTCCGCCAATAGCTCATATGACGACGTCCGCTCTCAAATCATCGAACTTGAAGGACAGAAAATGCTCAAA
ACGGTTCCTTCTGTCGAGGATTCTTCCGTCCCTCGACAAACCACCTGCAACGCAATCTCAAAACCCACATTATAT
CATAATAGCTTTTTCTCTTCGGAAGCGCCCATGGCTGCTGCACGAAAACAGTATCTCAAGATAATGTTCGGCGGT
GTGGTCGTGCTTACTTTAGTCATATTTATGATATTCTCCATCTTATGGGGTGCCTACTTTCGAACACCATCCTAT
AATCTCACCGGATGGATAATAGATTTCGATGGGAGTACAGTCGGCCAAGCAGTCGTCGATGGTTTGACGCAGCCT
GGCATACCTTCCAAGATCGACTGGAGTGTGCTACAGGCTGAACAATTTCCTGATGGTATCGTTGGCGTGTCTCAT
GCCGTAGCCGAACATCAAACATGGGTAGCGGTGACCGTGAACTCTGGCGCCTCCGATAGGCTGACAACATCCATC
AACTCACCCAACGCCACATATGATGGCTCAGAAGCCATTTCCGTTTTCACTGTTGAAGCAAGGAACGAGAACGCA
TTCCGCATAATAATTCGACCATCGGTAGAAACCATTTTGTCCATGATCTCTGCTCGGTTTGGATTACAAGTCGCA
CGATCACTCAGTGACTCCCCCGCAGTATCTCAGCTTCTCGCTACTTCCCCACAAACGGTGACAACTCCAATATCG
TATCAGCTGGTCAACCTGCGCCCTTTCAGCCAACCACTTGCAAGTCTCGTTATATTCACCGGTCTCATCTTCATG
ATCATATTGACGTTCTTCATTGCGGTGATCGGGAATGGTGCTAGGGAAGCGACGAATATTCATCGCCTGCTAAGA
TACCGGTCATTACTGGCGCTGCGGTTTACCACTATCTTCACGGCGTATTTCTTCCTTTCGTTATTCTACTCGTTG
CTCAGCTTGGCATTCCAACTTGATGTCAATGAAAAGTTCGGGAAGTCAAGTTTTCTCGTACTGTGGATGATGGAT
TACACGGGTATGCTAGCATTAGGCTTGGCCCTAGAGTCAATGCTCACCCTCGTTGGAATCAAATTCCTACCCATG
TTCTTGCTGCTATGGATCATGTCAAATGTTTCCGTTGTCGCCTTCCCGATCGAAGTACTTCCAATCATTTATCGG
TATGGATATGCTGCTCCATGCTATTGTATTTCGAAAATTGCACGCACCATTATTTTCGGCACAAAGAACCAAGTT
GGTTATTACTTCGGTATCTTGATTGCCTGGGTTGCCATTTCATGCCTTACGCTTACTCTGTTCCAATTCTTGGCA
AGAAGACGAGATGTTAGGGCTAATCAGCAGGGGCCACCTCCAACGGAAAAAGTGGAGGCGTAA
Transcript >AgabiH97|113800
ATGGCCTCCGCCAATAGCTCATATGACGACGTCCGCTCTCAAATCATCGAACTTGAAGGACAGAAAATGCTCAAA
ACGGTTCCTTCTGTCGAGGATTCTTCCGTCCCTCGACAAACCACCTGCAACGCAATCTCAAAACCCACATTATAT
CATAATAGCTTTTTCTCTTCGGAAGCGCCCATGGCTGCTGCACGAAAACAGTATCTCAAGATAATGTTCGGCGGT
GTGGTCGTGCTTACTTTAGTCATATTTATGATATTCTCCATCTTATGGGGTGCCTACTTTCGAACACCATCCTAT
AATCTCACCGGATGGATAATAGATTTCGATGGGAGTACAGTCGGCCAAGCAGTCGTCGATGGTTTGACGCAGCCT
GGCATACCTTCCAAGATCGACTGGAGTGTGCTACAGGCTGAACAATTTCCTGATGGTATCGTTGGCGTGTCTCAT
GCCGTAGCCGAACATCAAACATGGGTAGCGGTGACCGTGAACTCTGGCGCCTCCGATAGGCTGACAACATCCATC
AACTCACCCAACGCCACATATGATGGCTCAGAAGCCATTTCCGTTTTCACTGTTGAAGCAAGGAACGAGAACGCA
TTCCGCATAATAATTCGACCATCGGTAGAAACCATTTTGTCCATGATCTCTGCTCGGTTTGGATTACAAGTCGCA
CGATCACTCAGTGACTCCCCCGCAGTATCTCAGCTTCTCGCTACTTCCCCACAAACGGTGACAACTCCAATATCG
TATCAGCTGGTCAACCTGCGCCCTTTCAGCCAACCACTTGCAAGTCTCGTTATATTCACCGGTCTCATCTTCATG
ATCATATTGACGTTCTTCATTGCGGTGATCGGGAATGGTGCTAGGGAAGCGACGAATATTCATCGCCTGCTAAGA
TACCGGTCATTACTGGCGCTGCGGTTTACCACTATCTTCACGGCGTATTTCTTCCTTTCGTTATTCTACTCGTTG
CTCAGCTTGGCATTCCAACTTGATGTCAATGAAAAGTTCGGGAAGTCAAGTTTTCTCGTACTGTGGATGATGGAT
TACACGGGTATGCTAGCATTAGGCTTGGCCCTAGAGTCAATGCTCACCCTCGTTGGAATCAAATTCCTACCCATG
TTCTTGCTGCTATGGATCATGTCAAATGTTTCCGTTGTCGCCTTCCCGATCGAAGTACTTCCAATCATTTATCGG
TATGGATATGCTGCTCCATGCTATTGTATTTCGAAAATTGCACGCACCATTATTTTCGGCACAAAGAACCAAGTT
GGTTATTACTTCGGTATCTTGATTGCCTGGGTTGCCATTTCATGCCTTACGCTTACTCTGTTCCAATTCTTGGCA
AGAAGACGAGATGTTAGGGCTAATCAGCAGGGGCCACCTCCAACGGAAAAAGTGGAGGCGTAA
Gene >AgabiH97|113800
ATGGCCTCCGCCAATAGCTCATATGACGACGTCCGCTCTCAAATCATCGAACTTGAAGGACAGAAAATGCTCAAA
ACGGTTCCTTCTGTCGAGGATTCTTCCGTCCCTCGACAAACCACCTGCAACGCAATCTCAAAACCCACATTATAT
CATAATAGCTTTTTCTCTTCGGAAGCGCCCATGGCTGCTGCACGAAAACAGTATCTCAAGATAATGTTCGGCGGT
GTGGTCGTGCTTACTTTAGTCATATTTATGATATTCTCCATCTTATGGGGTGCCTACTTTCGAACACCATCCTAT
AATCTCACCGGATGGATAATAGTATGCCGTCAGTATTGTCATCAACTATTGTTATTGAATCGTTTCAAGGATTTC
GATGGGAGTACAGTCGGCCAAGCAGTCGTCGATGGTTTGACGCAGCCTGGCATACCTTCCAAGATCGACTGGAGT
GTGCTACAGGCTGAACAATTTCCTGATGGTATCGTTGGCGTGTCTCATGCCGTAGCCGAACATCAAACATGGGTA
GCGGTGACCGGTTCGTCTAACCTCTTCAAATCATTCGACGTCGCATTCTTCTAGTAAATTCTTAGTGAACTCTGG
CGCCTCCGATAGGCTGACAACATCCATCAACTCACCCAACGCCACATATGATGGCTCAGAAGCCATTTCCGTTTT
CACTGTTGAAGCAAGGAACGAGAACGCATTGTGAGGATACGGAGATTCATACCATCCCTTCCCTTCTAACCAGCT
TTTAGCCGCATAATAATTCGACCATCGGTGGGTTAATAGTAAACTATCCGACAACTATGTCCTTACCTTCCATAG
GTAGAAACCATTTTGTCCATGATCTCTGCTCGGTTTGGATTACAAGTCGCACGATCACTCAGTGACTCCCCCGCA
GTATCTCAGCTTCTCGCTACTTCCCCACAAACGGTGACAACTCCAATATCGTATCAGCTGGTCAACCTGCGCCCT
TTCAGCCAACCACTGTACGTGGAAATTGAAGCTACCATCCAACAGCGACTAACGCATTGATTCCAGTGCAAGTCT
CGTTATATTCACCGGTCTCATCTTCATGATCATATTGACGTTCTTCATTGCGGCACGTTCCGTCCTTCCTTCTCA
ATGTAATTAGCCTGATGTCCCCAATAGGTGATCGGGAATGGTGCTAGGGAAGCGACGAATATTCATCGCCTGCTA
AGATACCGGTCATTACTGGCGCTGCGGTTTACCACTATCTTCACGGCGTATTTCTTCCTTTCGGTCTGTATTAGC
TTTCGGTATCTTTCAAATTTGTTGACTTCCGCGTTTCATATAGTTATTCTACTCGTTGCTCAGCTTGGCATTCCA
ACTTGATGTCAATGAAAAGTGAGATTTTCTTGGAAATGTCTGCATAGTCAAATTGAAAAATGTAATCTAGGTTCG
GGAAGTCAAGTTTTCTCGTACTGTGGATGATGGATTACACGGGTATGCTAGCATTGTAAGAGGTCTATTCAATCC
CAAGTAACAACAATTAACGCGCTCTATAGAGGCTTGGCCCTAGAGTCAATGCTCACCCTCGTTGGAATCAAATTC
CTACCCATGTTCTTGCTGCTATGGATCATGTGTACGTTTATTCGGCCAGGACATATTCGGCGTGCTGATCCGATC
ACTGTAGCAAATGTTTCCGTTGTCGCCTTCCCGATCGAAGTACTTCCAATCATTTATCGGTATGGATATGCTGCT
CCATGCTATTGTATTTCGAAAATTGCACGCACCATTATTTTCGGCACAAAGAACCAAGGTAAAGTTGTTCTCCCC
TCCCAGCTCGAATCAAGGTATACTCAATTCTTCGGCCCGTAGTTGGTTATTACTTCGGTATCTTGATTGCCTGGG
TTGCCATTTCATGCCTTACGCTTACTCTGTTCCAATTCTTGGCAAGAAGACGAGATGTTAGGGCTAATCAGCAGG
GGCCACCTCCAACGGAAAAAGTGGAGGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail