Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|113490
Gene name
Locationscaffold_8:1923881..1925547
Strand+
Gene length (bp)1666
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13847 Methyltransf_31 Methyltransferase domain 9.6E-25 66 216
PF13649 Methyltransf_25 Methyltransferase domain 3.9E-18 70 171
PF08241 Methyltransf_11 Methyltransferase domain 8.0E-16 71 173
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.9E-13 63 174
PF00581 Rhodanese Rhodanese-like domain 1.7E-09 302 404
PF08242 Methyltransf_12 Methyltransferase domain 5.6E-09 71 172
PF13489 Methyltransf_23 Methyltransferase domain 1.1E-07 63 218
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 1.4E-06 63 121
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 2.7E-06 62 180

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O52025|ARSM_HALSA Putative arsenite methyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arsM PE=2 SV=1 35 270 2.0E-35
sp|Q91WU5|AS3MT_MOUSE Arsenite methyltransferase OS=Mus musculus GN=As3mt PE=1 SV=2 49 217 1.0E-24
sp|Q8VHT6|AS3MT_RAT Arsenite methyltransferase OS=Rattus norvegicus GN=As3mt PE=1 SV=1 66 217 5.0E-24
sp|Q9HBK9|AS3MT_HUMAN Arsenite methyltransferase OS=Homo sapiens GN=AS3MT PE=1 SV=3 70 320 4.0E-23
sp|P20187|YT37_STRFR Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 65 172 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O52025|ARSM_HALSA Putative arsenite methyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arsM PE=2 SV=1 35 270 2.0E-35
sp|Q91WU5|AS3MT_MOUSE Arsenite methyltransferase OS=Mus musculus GN=As3mt PE=1 SV=2 49 217 1.0E-24
sp|Q8VHT6|AS3MT_RAT Arsenite methyltransferase OS=Rattus norvegicus GN=As3mt PE=1 SV=1 66 217 5.0E-24
sp|Q9HBK9|AS3MT_HUMAN Arsenite methyltransferase OS=Homo sapiens GN=AS3MT PE=1 SV=3 70 320 4.0E-23
sp|P20187|YT37_STRFR Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 65 172 6.0E-11
sp|Q1R477|UBIE_ECOUT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|Q8FBJ0|UBIE_ECOL6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|Q0TAM1|UBIE_ECOL5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|A1AI22|UBIE_ECOK1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O1:K1 / APEC GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|B7N2E1|UBIE_ECO81 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O81 (strain ED1a) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|B7MHC0|UBIE_ECO45 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|Q3YVD2|UBIE_SHISS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella sonnei (strain Ss046) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|P0A889|UBIE_SHIFL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|Q0SZ25|UBIE_SHIF8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|Q32A11|UBIE_SHIDS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|Q31UF3|UBIE_SHIBS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|B2TVI4|UBIE_SHIB3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|B1LM21|UBIE_ECOSM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|B6I4H5|UBIE_ECOSE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SE11) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|B7NFD6|UBIE_ECOLU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|P0A887|UBIE_ECOLI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12) GN=ubiE PE=1 SV=1 62 172 8.0E-11
sp|B1IW72|UBIE_ECOLC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|A8A6U0|UBIE_ECOHS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O9:H4 (strain HS) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|B1XAJ7|UBIE_ECODH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / DH10B) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|C5A009|UBIE_ECOBW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|B7M638|UBIE_ECO8A Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O8 (strain IAI1) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|B7NV33|UBIE_ECO7I Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|B5YY82|UBIE_ECO5E Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|P0A888|UBIE_ECO57 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|B7L996|UBIE_ECO55 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain 55989 / EAEC) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|B7UNG3|UBIE_ECO27 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|A7ZU40|UBIE_ECO24 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiE PE=3 SV=1 62 172 8.0E-11
sp|A1JIF2|UBIE_YERE8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiE PE=3 SV=1 62 232 5.0E-10
sp|B7LU01|UBIE_ESCF3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ubiE PE=3 SV=1 62 172 6.0E-10
sp|Q8CWG0|MENG_OCEIH Demethylmenaquinone methyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menG PE=3 SV=1 59 173 8.0E-10
sp|A4WFY5|UBIE_ENT38 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Enterobacter sp. (strain 638) GN=ubiE PE=3 SV=1 64 172 9.0E-10
sp|A6WYI0|UBIE_OCHA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ubiE PE=3 SV=1 65 234 9.0E-10
sp|A6TGL3|UBIE_KLEP7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiE PE=3 SV=1 62 172 9.0E-10
sp|B5XYI1|UBIE_KLEP3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae (strain 342) GN=ubiE PE=3 SV=1 62 172 9.0E-10
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 63 272 1.0E-09
sp|P59911|UBIE_HAEDU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiE PE=3 SV=1 64 172 1.0E-09
sp|B1JP75|UBIE_YERPY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ubiE PE=3 SV=1 62 232 1.0E-09
sp|Q66FT0|UBIE_YERPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiE PE=3 SV=1 62 232 1.0E-09
sp|A4TR39|UBIE_YERPP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis (strain Pestoides F) GN=ubiE PE=3 SV=1 62 232 1.0E-09
sp|Q1CNB4|UBIE_YERPN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiE PE=3 SV=1 62 232 1.0E-09
sp|A9R431|UBIE_YERPG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiE PE=3 SV=1 62 232 1.0E-09
sp|Q8D1I3|UBIE_YERPE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis GN=ubiE PE=3 SV=1 62 232 1.0E-09
sp|B2K0Y4|UBIE_YERPB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiE PE=3 SV=1 62 232 1.0E-09
sp|A7FDE0|UBIE_YERP3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiE PE=3 SV=1 62 232 1.0E-09
sp|Q1CBG0|UBIE_YERPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiE PE=3 SV=1 62 232 2.0E-09
sp|A8ACY2|UBIE_CITK8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ubiE PE=3 SV=1 64 172 3.0E-09
sp|A7MQL7|UBIE_CROS8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiE PE=3 SV=1 64 232 3.0E-09
sp|C3LPS5|UBIE_VIBCM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiE PE=3 SV=1 65 172 4.0E-09
sp|Q9KVQ6|UBIE_VIBCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiE PE=3 SV=1 65 172 4.0E-09
sp|A5F4E5|UBIE_VIBC3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiE PE=3 SV=1 65 172 4.0E-09
sp|Q8FUZ3|UBIE_BRUSU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis biovar 1 (strain 1330) GN=ubiE PE=3 SV=1 57 235 4.0E-09
sp|P0A2K5|UBIE_SALTY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|P0A2K6|UBIE_SALTI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhi GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|B4TNX9|UBIE_SALSV Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|B5BIX9|UBIE_SALPK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain AKU_12601) GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|C0Q3E1|UBIE_SALPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi C (strain RKS4594) GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|A9MY97|UBIE_SALPB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|Q5PKP4|UBIE_SALPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|B4SZ73|UBIE_SALNS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella newport (strain SL254) GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|B4TBR3|UBIE_SALHS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella heidelberg (strain SL476) GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|B5RFM8|UBIE_SALG2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|B5QW73|UBIE_SALEP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|B5FNW6|UBIE_SALDC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella dublin (strain CT_02021853) GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|Q57HN8|UBIE_SALCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella choleraesuis (strain SC-B67) GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|B5EZU8|UBIE_SALA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella agona (strain SL483) GN=ubiE PE=3 SV=1 62 172 4.0E-09
sp|A9MIY3|UBIE_SALAR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ubiE PE=3 SV=1 62 172 5.0E-09
sp|B3PH48|UBIE_CELJU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cellvibrio japonicus (strain Ueda107) GN=ubiE PE=3 SV=1 59 232 5.0E-09
sp|A9MCZ2|UBIE_BRUC2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ubiE PE=3 SV=1 65 235 6.0E-09
sp|Q9CKD6|UBIE_PASMU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pasteurella multocida (strain Pm70) GN=ubiE PE=3 SV=1 64 172 6.0E-09
sp|Q8YDE4|UBIE_BRUME Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ubiE PE=3 SV=1 65 234 1.0E-08
sp|C0RMK3|UBIE_BRUMB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ubiE PE=3 SV=1 65 234 1.0E-08
sp|Q576Q0|UBIE_BRUAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus biovar 1 (strain 9-941) GN=ubiE PE=3 SV=1 65 234 1.0E-08
sp|Q2YJM4|UBIE_BRUA2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain 2308) GN=ubiE PE=3 SV=1 65 234 1.0E-08
sp|B2SC50|UBIE_BRUA1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain S19) GN=ubiE PE=3 SV=1 65 234 1.0E-08
sp|A7MTX1|UBIE_VIBCB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiE PE=3 SV=1 65 232 2.0E-08
sp|Q87TH4|UBIE_VIBPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiE PE=3 SV=1 65 232 3.0E-08
sp|Q7MQ33|UBIE_VIBVY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain YJ016) GN=ubiE PE=3 SV=1 65 232 3.0E-08
sp|Q8DDP9|UBIE_VIBVU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain CMCP6) GN=ubiE PE=3 SV=1 65 232 3.0E-08
sp|Q8WZK3|IBP1_SCHPO Dual specificity phosphatase ibp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ibp1 PE=1 SV=1 320 417 3.0E-08
sp|A8G8B8|UBIE_SERP5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Serratia proteamaculans (strain 568) GN=ubiE PE=3 SV=1 62 172 4.0E-08
sp|C6DI77|UBIE_PECCP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ubiE PE=3 SV=1 64 172 5.0E-08
sp|Q7VRJ1|UBIE_BLOFL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Blochmannia floridanus GN=ubiE PE=3 SV=1 59 235 5.0E-08
sp|Q3ED65|MENG_ARATH 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=MENG PE=1 SV=2 65 178 5.0E-08
sp|Q6DAQ7|UBIE_PECAS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ubiE PE=3 SV=1 64 172 1.0E-07
sp|Q2SN12|UBIE_HAHCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Hahella chejuensis (strain KCTC 2396) GN=ubiE PE=3 SV=1 59 172 1.0E-07
sp|A6UFF7|UBIE_SINMW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Sinorhizobium medicae (strain WSM419) GN=ubiE PE=3 SV=1 65 234 1.0E-07
sp|Q5NFE1|UBIE_FRATT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ubiE PE=3 SV=1 59 231 1.0E-07
sp|Q14GU4|UBIE_FRAT1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=ubiE PE=3 SV=1 59 231 1.0E-07
sp|B0TZP1|UBIE_FRAP2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=ubiE PE=3 SV=1 59 231 1.0E-07
sp|B3PI89|BIOHC_CELJU Biotin biosynthesis bifunctional protein BioHC OS=Cellvibrio japonicus (strain Ueda107) GN=bioC PE=3 SV=1 70 229 1.0E-07
sp|A6VTA1|UBIE_MARMS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Marinomonas sp. (strain MWYL1) GN=ubiE PE=3 SV=1 59 232 1.0E-07
sp|B7GHP8|MENG_ANOFW Demethylmenaquinone methyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=menG PE=3 SV=1 59 231 1.0E-07
sp|Q06597|ARR2_YEAST Arsenical-resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARR2 PE=3 SV=1 299 403 2.0E-07
sp|Q10SX6|ACR22_ORYSJ Arsenate reductase 2.2 OS=Oryza sativa subsp. japonica GN=ACR2.2 PE=1 SV=1 299 403 2.0E-07
sp|P96576|YDAC_BACSU Uncharacterized methyltransferase YdaC OS=Bacillus subtilis (strain 168) GN=ydaC PE=3 SV=1 59 235 2.0E-07
sp|B2SFA2|UBIE_FRATM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=ubiE PE=3 SV=1 59 231 2.0E-07
sp|A0Q549|UBIE_FRATN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. novicida (strain U112) GN=ubiE PE=3 SV=1 59 231 3.0E-07
sp|C5BCA4|UBIE_EDWI9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Edwardsiella ictaluri (strain 93-146) GN=ubiE PE=3 SV=1 62 172 3.0E-07
sp|A9WW74|UBIE_BRUSI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ubiE PE=3 SV=1 65 232 3.0E-07
sp|P49016|MENG_LACLA Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 67 228 3.0E-07
sp|Q0BNE2|UBIE_FRATO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=ubiE PE=3 SV=1 59 231 4.0E-07
sp|Q2A524|UBIE_FRATH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. holarctica (strain LVS) GN=ubiE PE=3 SV=1 59 231 4.0E-07
sp|A7NAA1|UBIE_FRATF Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=ubiE PE=3 SV=1 59 231 4.0E-07
sp|B2VG41|UBIE_ERWT9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiE PE=3 SV=1 64 172 4.0E-07
sp|A1SRS4|UBIE_PSYIN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Psychromonas ingrahamii (strain 37) GN=ubiE PE=3 SV=1 64 172 6.0E-07
sp|Q7MZ81|UBIE_PHOLL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiE PE=3 SV=1 62 232 7.0E-07
sp|Q3IJV7|UBIE_PSEHT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ubiE PE=3 SV=1 59 232 9.0E-07
sp|O66128|MENG_MICLU Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 59 171 9.0E-07
sp|Q92SK7|UBIE_RHIME Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium meliloti (strain 1021) GN=ubiE PE=3 SV=2 65 234 1.0E-06
sp|P42937|YCH1_YEAST CDC25-like phosphatase YCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCH1 PE=1 SV=1 287 407 1.0E-06
sp|Q12S23|UBIE_SHEDO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ubiE PE=3 SV=1 59 232 1.0E-06
sp|A4IXH9|UBIE_FRATW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ubiE PE=3 SV=1 59 231 1.0E-06
sp|O86169|MENG_GEOSE Demethylmenaquinone methyltransferase OS=Geobacillus stearothermophilus GN=menG PE=3 SV=1 59 171 2.0E-06
sp|Q8GY31|CDC25_ARATH Dual specificity phosphatase Cdc25 OS=Arabidopsis thaliana GN=CDC25 PE=1 SV=1 299 403 2.0E-06
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 59 171 2.0E-06
sp|Q5QYG2|UBIE_IDILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiE PE=3 SV=1 64 172 2.0E-06
sp|C5D3E5|MENG_GEOSW Demethylmenaquinone methyltransferase OS=Geobacillus sp. (strain WCH70) GN=menG PE=3 SV=1 59 231 2.0E-06
sp|Q54818|DNRC_STRPE Aklanonic acid methyltransferase DnrC OS=Streptomyces peucetius GN=dnrC PE=1 SV=1 12 179 2.0E-06
sp|Q9HUC0|UBIE_PSEAE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiE PE=3 SV=1 59 172 2.0E-06
sp|Q02EV4|UBIE_PSEAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiE PE=3 SV=1 59 172 2.0E-06
sp|B7V3F6|UBIE_PSEA8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiE PE=3 SV=1 59 172 2.0E-06
sp|A9KYL8|UBIE_SHEB9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS195) GN=ubiE PE=3 SV=1 65 232 2.0E-06
sp|A6WIE9|UBIE_SHEB8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS185) GN=ubiE PE=3 SV=1 65 232 2.0E-06
sp|A3D9F2|UBIE_SHEB5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiE PE=3 SV=1 65 232 2.0E-06
sp|B8E6B6|UBIE_SHEB2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS223) GN=ubiE PE=3 SV=1 65 232 2.0E-06
sp|A1RP78|UBIE_SHESW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain W3-18-1) GN=ubiE PE=3 SV=1 65 232 2.0E-06
sp|A4Y2Q5|UBIE_SHEPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiE PE=3 SV=1 65 232 2.0E-06
sp|Q3MD91|MENG_ANAVT 2-phytyl-1,4-naphtoquinone methyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=menG PE=3 SV=1 59 178 3.0E-06
sp|Q84BQ9|PRMA_THET8 Ribosomal protein L11 methyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=prmA PE=1 SV=2 37 182 3.0E-06
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 52 194 3.0E-06
sp|Q88D17|UBIE_PSEPK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain KT2440) GN=ubiE PE=3 SV=1 64 232 3.0E-06
sp|A5WA45|UBIE_PSEP1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiE PE=3 SV=1 64 232 3.0E-06
sp|Q2NYW4|UBIE_XANOM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiE PE=3 SV=1 59 232 4.0E-06
sp|Q5N4X9|MENG_SYNP6 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=menG PE=3 SV=1 59 178 4.0E-06
sp|Q31P90|MENG_SYNE7 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=menG PE=3 SV=1 59 178 4.0E-06
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 59 171 4.0E-06
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 59 171 4.0E-06
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 59 171 4.0E-06
sp|P67062|MENG_STAAN Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 59 171 4.0E-06
sp|P67061|MENG_STAAM Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 59 171 4.0E-06
sp|A6QH20|MENG_STAAE Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 59 171 4.0E-06
sp|Q5HFV2|MENG_STAAC Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 59 171 4.0E-06
sp|A5ISZ9|MENG_STAA9 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 59 171 4.0E-06
sp|A6U1T9|MENG_STAA2 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 59 171 4.0E-06
sp|A7X2H6|MENG_STAA1 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 59 171 4.0E-06
sp|Q9Z5E9|UBIE_PSEOL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (Fragment) OS=Pseudomonas oleovorans GN=ubiE PE=3 SV=1 62 172 4.0E-06
sp|Q67LE6|MENG_SYMTH Demethylmenaquinone methyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=menG PE=3 SV=1 59 172 4.0E-06
sp|Q1LIT8|PRMA_CUPMC Ribosomal protein L11 methyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=prmA PE=3 SV=1 61 179 4.0E-06
sp|A6VDI6|UBIE_PSEA7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain PA7) GN=ubiE PE=3 SV=1 59 232 4.0E-06
sp|Q73AY2|MENG_BACC1 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menG PE=3 SV=1 59 173 5.0E-06
sp|Q1I3T0|UBIE_PSEE4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas entomophila (strain L48) GN=ubiE PE=3 SV=1 59 172 6.0E-06
sp|Q9Z439|UBIE_PSEPU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida GN=ubiE PE=3 SV=1 59 172 6.0E-06
sp|B0KM36|UBIE_PSEPG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain GB-1) GN=ubiE PE=3 SV=1 64 232 7.0E-06
sp|Q21H69|UBIE_SACD2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ubiE PE=3 SV=1 62 234 7.0E-06
sp|C3K8U4|UBIE_PSEFS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas fluorescens (strain SBW25) GN=ubiE PE=3 SV=1 59 172 8.0E-06
sp|Q4ZZG3|UBIE_PSEU2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiE PE=3 SV=1 59 172 9.0E-06
sp|B1J2S8|UBIE_PSEPW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain W619) GN=ubiE PE=3 SV=1 64 172 9.0E-06
sp|Q48PJ4|UBIE_PSE14 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiE PE=3 SV=1 59 172 9.0E-06
sp|Q87UZ2|UBIE_PSESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiE PE=3 SV=1 64 172 9.0E-06
sp|Q8PPP2|UBIE_XANAC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiE PE=3 SV=1 59 232 9.0E-06
sp|Q8E9R7|UBIE_SHEON Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella oneidensis (strain MR-1) GN=ubiE PE=3 SV=1 65 232 9.0E-06
sp|Q2NSL7|UBIG_SODGM Ubiquinone biosynthesis O-methyltransferase OS=Sodalis glossinidius (strain morsitans) GN=ubiG PE=3 SV=1 67 178 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|113490
MASSEGITQIVNAAYSERAAKGVDANVSIAVASAVGYSTTELASVPSGSSLGLSCGTPVKDANLREGESVLDLGS
GGGLDVFLAADLVGTTGKVVGLDGSKAMVDLSRQNAKAKGVKPPHVAFAQASFTEELPIEPCSVDCVISNCVLNL
LPDDGKALTLRETYRVLRPGGRAHFSDIVAIRDIPAELKEDPVMHVNCISGAISWQKYEDLLRKAGFIDISFSNV
TNGLSACCTAPLQLTKSDRHPATETISSFDVDKFVASNRILARKPESPQEKISSTILKQWWDAYPLVNSSPEAMT
AEEVASLIRDPSKNVQDFVVVDVRRNDHAGGHVKGSVQCPAQSFYDDAPAYFEKFKDTEKVIFYCQSSNGRGPRC
AGWYQDYLDSMGCSSSKAYVLAGGIKGWMGKYKGQHDLMDYD*
Coding >AgabiH97|113490
ATGGCTTCATCTGAAGGTATCACACAAATTGTCAACGCAGCTTATAGTGAGCGTGCAGCGAAGGGAGTAGATGCT
AACGTTTCCATTGCTGTCGCATCTGCCGTCGGGTACTCAACAACAGAACTTGCCAGCGTACCTTCAGGCTCGAGT
CTCGGTCTGAGTTGTGGTACTCCAGTCAAAGATGCAAATCTTCGAGAAGGGGAGTCTGTCCTCGACCTTGGTTCG
GGAGGTGGGCTGGATGTCTTTTTGGCCGCTGACCTAGTTGGAACCACTGGCAAAGTTGTCGGTCTCGATGGATCC
AAGGCAATGGTCGACCTCTCACGGCAGAACGCTAAGGCTAAAGGAGTAAAGCCACCTCATGTAGCGTTCGCTCAG
GCATCATTCACAGAAGAGCTGCCGATAGAACCATGTTCTGTGGATTGTGTTATCTCGAATTGTGTCCTAAATCTT
TTGCCAGATGATGGAAAGGCTTTAACTTTGAGGGAGACGTATCGTGTCTTGCGACCCGGAGGGAGAGCTCATTTT
AGCGATATCGTTGCTATACGTGATATCCCGGCCGAACTAAAGGAAGACCCAGTTATGCACGTAAACTGTATATCT
GGTGCCATCTCATGGCAAAAATATGAGGACCTTCTGCGAAAAGCTGGTTTCATTGATATTTCTTTCTCTAACGTT
ACAAACGGACTCAGCGCATGCTGTACTGCACCATTGCAACTGACGAAATCCGATCGGCATCCGGCAACAGAAACT
ATATCCTCTTTTGATGTAGATAAATTCGTTGCATCAAATCGAATTTTGGCTCGCAAGCCAGAGAGTCCCCAAGAG
AAGATATCGTCCACGATTCTTAAACAATGGTGGGACGCGTATCCTCTCGTAAATTCATCTCCAGAAGCGATGACG
GCGGAGGAAGTCGCTTCTCTCATTCGTGATCCGTCTAAGAACGTGCAAGATTTTGTCGTAGTGGACGTCCGGAGA
AACGATCATGCTGGCGGCCACGTTAAGGGAAGCGTCCAATGTCCCGCACAATCCTTTTATGACGATGCACCAGCA
TACTTTGAGAAGTTCAAAGACACTGAAAAAGTCATATTTTACTGTCAGAGTTCCAACGGTCGCGGTCCACGCTGT
GCTGGTTGGTATCAGGACTATCTTGATTCCATGGGTTGTTCCTCTTCAAAAGCGTACGTTTTAGCCGGTGGCATC
AAGGGATGGATGGGGAAATACAAAGGACAACACGACTTGATGGATTACGATTAA
Transcript >AgabiH97|113490
ATGGCTTCATCTGAAGGTATCACACAAATTGTCAACGCAGCTTATAGTGAGCGTGCAGCGAAGGGAGTAGATGCT
AACGTTTCCATTGCTGTCGCATCTGCCGTCGGGTACTCAACAACAGAACTTGCCAGCGTACCTTCAGGCTCGAGT
CTCGGTCTGAGTTGTGGTACTCCAGTCAAAGATGCAAATCTTCGAGAAGGGGAGTCTGTCCTCGACCTTGGTTCG
GGAGGTGGGCTGGATGTCTTTTTGGCCGCTGACCTAGTTGGAACCACTGGCAAAGTTGTCGGTCTCGATGGATCC
AAGGCAATGGTCGACCTCTCACGGCAGAACGCTAAGGCTAAAGGAGTAAAGCCACCTCATGTAGCGTTCGCTCAG
GCATCATTCACAGAAGAGCTGCCGATAGAACCATGTTCTGTGGATTGTGTTATCTCGAATTGTGTCCTAAATCTT
TTGCCAGATGATGGAAAGGCTTTAACTTTGAGGGAGACGTATCGTGTCTTGCGACCCGGAGGGAGAGCTCATTTT
AGCGATATCGTTGCTATACGTGATATCCCGGCCGAACTAAAGGAAGACCCAGTTATGCACGTAAACTGTATATCT
GGTGCCATCTCATGGCAAAAATATGAGGACCTTCTGCGAAAAGCTGGTTTCATTGATATTTCTTTCTCTAACGTT
ACAAACGGACTCAGCGCATGCTGTACTGCACCATTGCAACTGACGAAATCCGATCGGCATCCGGCAACAGAAACT
ATATCCTCTTTTGATGTAGATAAATTCGTTGCATCAAATCGAATTTTGGCTCGCAAGCCAGAGAGTCCCCAAGAG
AAGATATCGTCCACGATTCTTAAACAATGGTGGGACGCGTATCCTCTCGTAAATTCATCTCCAGAAGCGATGACG
GCGGAGGAAGTCGCTTCTCTCATTCGTGATCCGTCTAAGAACGTGCAAGATTTTGTCGTAGTGGACGTCCGGAGA
AACGATCATGCTGGCGGCCACGTTAAGGGAAGCGTCCAATGTCCCGCACAATCCTTTTATGACGATGCACCAGCA
TACTTTGAGAAGTTCAAAGACACTGAAAAAGTCATATTTTACTGTCAGAGTTCCAACGGTCGCGGTCCACGCTGT
GCTGGTTGGTATCAGGACTATCTTGATTCCATGGGTTGTTCCTCTTCAAAAGCGTACGTTTTAGCCGGTGGCATC
AAGGGATGGATGGGGAAATACAAAGGACAACACGACTTGATGGATTACGATTAA
Gene >AgabiH97|113490
ATGGCTTCATCTGAAGGTATCACACAAATTGTCAACGCAGCTTATAGTGAGCGTGCAGCGAAGGGAGTAGATGCT
AACGGTATAATCAATGGTCGTTTTTTCTTTGTCTTCTCTTTGATGTCTCCTCCATAGTTTCCATTGCTGTCGCAT
CTGCCGTCGGGTACTCAACAACAGAACTTGCCAGCGTACCTTCAGGCTCGAGTCTCGGTCTGAGTTGTGGTACTC
CAGTCAAAGATGCAAATCTTCGAGAAGTAGACCCTTTTTTTTGACATACGACGCGGTCTTACATTCAATCAGGGG
GAGTCTGTCCTCGACCTTGGTTCGGGAGGTGGGCTGGATGTCTTTTTGGCCGCTGACCTAGTTGGAACCACTGGC
AAAGTTGTCGGTCTCGATGGATCCAAGGTACGCGTCATTCTAGGATATATCCCAGTGGTCTTACCATTGTCAATT
TGTATAGGCAATGGTCGACCTCTCACGGCAGAACGCTAAGGCTAAAGGAGTAAAGCCACCTCATGTAGCGTTCGC
TCAGGCATCATTCACAGAAGAGCTGCCGATAGAACCATGTTCTGTGGATTGTGTTATCTCGAATTGTGTCCTAAA
TCTTTTGCCAGATGATGGAAAGGCTTTAACTTTGAGGGAGACGTATCGTGTCTTGCGACCCGGAGGGAGAGCTCA
TTTTAGCGATGTAGGCTGCTCACAAACTTGAATCCTAACCGAAATGCTAATCCTTCATAGATCGTTGCTATACGT
GATATCCCGGCCGAACTAAAGGAAGACCCAGTTATGCACGTAAACTGTATATCTGGTGCCATCTCATGGCAAAAA
TATGAGGACCTTCTGCGAAAAGCTGGTTTCATTGGCAAGAGCTAGTCATTTTCTGTCTGCCCATGTGGCTCATAT
AGTATTCATCAACAGATATTTCTTTCTCTAACGTTACAAACGGACTCAGCGCATGCTGTACTGCACCATTGCAAC
TGACGAAATCCGATCGGCATCCGGCAACAGAAACTATATCCTCTTTTGATGTAGATAAATTCGTTGGTAAGGCTT
CCTTTTTCAATGATCGTTGGCTACCTCACGCCACATAGCATCAAATCGAATTTTGGCTCGCAAGCCAGAGAGTCC
CCAAGAGAAGATATCGTCCACGATTCTTAAACAATGGTGGGACGCGTATCCTCTCGTAAATTCATCTCCAGAAGC
GATGACGGCGGAGGAAGTCGCTTCTCTCATTCGTGATCCGTCTAAGAACGTGCAAGATTTTGTCGTAGTGGACGT
CCGGAGAAACGATCATGCTGTGAGCTTCAGTTTTATTTTTCGCTGATAATTGTGCTGATTGTCTATTGCCAGGGC
GGCCACGTTAAGGGAAGCGTCCAATGTCCCGCACAATCCTTTTATGACGATGCACCAGCATACTTTGAGAAGTTC
AAAGACACTGAAAAAGTCATATTTTACTGTCAGAGTTCCAACGGTCGCGGTCCACGCTGTGCTGGTTGGTAGGTC
GCTCGCATTCAATCAGGTTTGACTTCATCTGAAAGTGTATTCCAGGTATCAGGACTATCTTGATTCCATGGGTTG
TTCCTCTTCAAAAGCGTACGTTTTAGCCGGTGGCATCAAGGGATGGATGGGGAAATACAAAGGACAACACGACTT
GATGGATTACGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail