Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|113460
Gene name
Locationscaffold_8:1917452..1918471
Strand-
Gene length (bp)1019
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 8.2E-08 134 196
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 1.1E-06 65 190

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0016407 acetyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016410 N-acyltransferase activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|113460
MSQSSYRVKLLDKSTLDERTLDHLISLSASAFGSEDQWVLSGTGGNPNLVDGFFRSRLMAGVVSPRGYIYVSLFE
EEIVGVALWFGPGDELFATEEQRAAHYDKWNQERGPALVQWWNVNQAPPVNQLVKNSRKDTWSLSLLAVSPHHRR
RRIAYNLCKFVMDKAMAQGEGASVLTQSQDNVKIYETMGFSMFGDVKIVGGPGGDYTIFSLTFNWPPMEPEHKQ*
Coding >AgabiH97|113460
ATGTCGCAATCCTCTTACAGAGTGAAGCTGCTTGACAAGTCCACCCTAGATGAACGTACTCTTGATCACCTCATC
TCTCTAAGTGCATCGGCTTTCGGAAGCGAAGACCAATGGGTATTATCTGGCACAGGGGGGAATCCAAACCTGGTG
GACGGGTTCTTTCGGTCGCGCCTTATGGCCGGAGTAGTTTCTCCCCGGGGATACATATATGTTTCACTGTTTGAA
GAAGAAATAGTCGGCGTCGCCCTGTGGTTCGGTCCAGGTGACGAATTATTTGCTACGGAAGAGCAACGAGCAGCT
CACTATGATAAATGGAACCAGGAACGAGGCCCTGCCTTAGTCCAGTGGTGGAATGTAAACCAAGCTCCTCCCGTC
AATCAACTCGTCAAAAACAGCCGGAAGGATACGTGGAGTCTATCACTTCTAGCTGTATCACCTCACCATCGTAGA
AGACGAATTGCTTATAATCTTTGTAAATTCGTGATGGATAAAGCTATGGCTCAGGGTGAAGGAGCTAGTGTTCTG
ACACAATCTCAAGACAATGTCAAGATTTATGAAACCATGGGGTTCAGTATGTTCGGAGACGTGAAGATTGTTGGA
GGACCAGGGGGTGACTACACCATTTTCTCATTGACGTTCAACTGGCCACCTATGGAACCCGAACATAAGCAATAA
Transcript >AgabiH97|113460
ATGTCGCAATCCTCTTACAGAGTGAAGCTGCTTGACAAGTCCACCCTAGATGAACGTACTCTTGATCACCTCATC
TCTCTAAGTGCATCGGCTTTCGGAAGCGAAGACCAATGGGTATTATCTGGCACAGGGGGGAATCCAAACCTGGTG
GACGGGTTCTTTCGGTCGCGCCTTATGGCCGGAGTAGTTTCTCCCCGGGGATACATATATGTTTCACTGTTTGAA
GAAGAAATAGTCGGCGTCGCCCTGTGGTTCGGTCCAGGTGACGAATTATTTGCTACGGAAGAGCAACGAGCAGCT
CACTATGATAAATGGAACCAGGAACGAGGCCCTGCCTTAGTCCAGTGGTGGAATGTAAACCAAGCTCCTCCCGTC
AATCAACTCGTCAAAAACAGCCGGAAGGATACGTGGAGTCTATCACTTCTAGCTGTATCACCTCACCATCGTAGA
AGACGAATTGCTTATAATCTTTGTAAATTCGTGATGGATAAAGCTATGGCTCAGGGTGAAGGAGCTAGTGTTCTG
ACACAATCTCAAGACAATGTCAAGATTTATGAAACCATGGGGTTCAGTATGTTCGGAGACGTGAAGATTGTTGGA
GGACCAGGGGGTGACTACACCATTTTCTCATTGACGTTCAACTGGCCACCTATGGAACCCGAACATAAGCAATAA
Gene >AgabiH97|113460
ATGTCGCAATCCTCTTACAGAGTGAAGCTGCTTGACAAGTCCACCCTAGGTATATATCCCCCCGCCCTCTTTAGC
TCTCTCAGCCAGAAGTACAAATTGATCTCACACCCCGACTTCACGGACAGATGAACGTACTCTTGATCACCTCAT
CTCTCTAAGTGCATCGGCTTTCGGAAGCGGTGCGGCTTCTCTTTTACCGCTCGCAAAGATAACAAAATTGATATT
CTCTACTAGAAGACCAATGGGTATTATCTGGCACAGGGGGGAATCCAAACCTGGTGGACGGGTTCTTTCGGTCGC
GCCTTATGGCCGGAGTAGTTTCTCCCCGGGGATACATATATGTTTCACTGTTTGAAGAAGAAATAGTCGGCGTCG
CCCTGTGGTTCGGTCCAGGTGACGAATTATTTGCTACGTAAATTCGATTTCTCTCAGTCAAGATGGCGTATCGAC
TTTATCTTTTCATATAGGGAAGAGCAACGAGCAGCTCACTATGATAAATGGAACCAGGAACGAGGCCCTGCCTTA
GTCCAGTGGTGGAATGTAAACGTGGGTCATTCCAGCAACTATCTCTTTGAATATCATTTTATATATTATTTTGTT
GCAGCAAGCTCCTCCCGTCAATCAACTCGTCAAAAACAGCCGGAAGGATACGTGGAGTCTATCACTTCTAGCTGT
ATCACCTCACCATCGTAGAAGACGAATTGCTTATAATCTTTGTAAATTCGTGATGGATAAAGTTAGTCTCCGAGG
ATGTCAATATCCTCCGACGTTGATTATTTTCACAGGCTATGGCTCAGGGTGAAGGAGCTAGTGTTCTGACACAAT
CTCAAGACAATGTGAGTCAAATGCCTCATGCTGAGCTGCAGCTGAGAATAGCCTATTGTCAGGTCAAGATTTATG
AAACCATGGGGTTCAGTATGTTCGGAGACGTGAAGATTGTTGGAGGACCAGGGGGTGACTACACCATTTTCTCAT
TGACGTTCAACTGGCCACCTATGGAACCCGAACATAAGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail