Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|113360
Gene name
Locationscaffold_8:1898208..1898816
Strand+
Gene length (bp)608
Transcript length (bp)492
Coding sequence length (bp)492
Protein length (aa) 164

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 6.0E-11 27 156

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|113360
MLSSKFFSLLTFAAAAVARIPTGQFFITNIETEKVLEAGNGSSGPDAFIVVAKRNRRNNAQIWSHTKGSGFLRNE
ASQLVLEVPRTNGAVEYGTKLQEGELRDEANVDSTQLWDYDEDAQHLFTLADTNACLTAEGSAQYAIVDFCDTQD
NDSQRWELVSVRD*
Coding >AgabiH97|113360
ATGCTCTCCTCCAAATTCTTCTCCCTTCTTACTTTCGCTGCCGCTGCTGTTGCTCGAATCCCAACTGGCCAGTTC
TTTATCACTAACATCGAGACTGAAAAGGTCTTGGAAGCCGGAAATGGGAGCTCAGGTCCTGATGCATTCATTGTC
GTTGCGAAACGCAACAGACGCAACAACGCCCAAATCTGGTCACACACCAAGGGCAGTGGATTCTTAAGAAACGAA
GCCTCCCAACTTGTTCTTGAAGTACCCAGGACGAATGGTGCTGTCGAATATGGAACGAAGTTACAGGAAGGGGAG
CTTAGGGATGAAGCTAATGTCGATTCGACTCAGTTGTGGGACTATGATGAAGACGCACAACATTTGTTCACACTG
GCCGATACTAATGCATGCCTTACTGCGGAGGGCTCAGCGCAGTATGCTATAGTTGACTTTTGTGACACTCAAGAT
AACGATTCTCAACGGTGGGAATTAGTCAGTGTCAGAGATTAG
Transcript >AgabiH97|113360
ATGCTCTCCTCCAAATTCTTCTCCCTTCTTACTTTCGCTGCCGCTGCTGTTGCTCGAATCCCAACTGGCCAGTTC
TTTATCACTAACATCGAGACTGAAAAGGTCTTGGAAGCCGGAAATGGGAGCTCAGGTCCTGATGCATTCATTGTC
GTTGCGAAACGCAACAGACGCAACAACGCCCAAATCTGGTCACACACCAAGGGCAGTGGATTCTTAAGAAACGAA
GCCTCCCAACTTGTTCTTGAAGTACCCAGGACGAATGGTGCTGTCGAATATGGAACGAAGTTACAGGAAGGGGAG
CTTAGGGATGAAGCTAATGTCGATTCGACTCAGTTGTGGGACTATGATGAAGACGCACAACATTTGTTCACACTG
GCCGATACTAATGCATGCCTTACTGCGGAGGGCTCAGCGCAGTATGCTATAGTTGACTTTTGTGACACTCAAGAT
AACGATTCTCAACGGTGGGAATTAGTCAGTGTCAGAGATTAG
Gene >AgabiH97|113360
ATGCTCTCCTCCAAATTCTTCTCCCTTCTTACTTTCGCTGCCGCTGCTGTTGCTCGAATCCCAACTGGCCAGTTC
TTTATCACTAACATCGAGACTGAAAAGGTCTTGGAAGCCGGAAATGGGAGCTCAGGTGTAAATGCCGAATCTGTT
TCAACTTCCTGTTTGATCATTGACCTTCTATTTAGCCTGATGCATTCATTGTCGTTGCGAAACGCAACAGACGCA
ACAACGCCCAAATCTGGTCACACACCAAGGGCAGTGGATTCTTAAGAAACGAAGCCTCCCAACTTGTTCTTGAAG
TACCCAGTGAGTTTGAGGTTGTGTAACAAATCGTCTGTGTAGGTGAATTTAATGTTTTTCTATGCATAGGGACGA
ATGGTGCTGTCGAATATGGAACGAAGTTACAGGAAGGGGAGCTTAGGGATGAAGCTAATGTCGATTCGACTCAGT
TGTGGGACTATGATGAAGACGCACAACATTTGTTCACACTGGCCGATACTAATGCATGCCTTACTGCGGAGGGCT
CAGCGCAGTATGCTATAGTTGACTTTTGTGACACTCAAGATAACGATTCTCAACGGTGGGAATTAGTCAGTGTCA
GAGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail