Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|113350
Gene name
Locationscaffold_8:1896680..1897289
Strand+
Gene length (bp)609
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 301.50 141.74 461.25
Initials Initials knots 6.59 2.22 10.95
Pileal_Stipeal_center Stage I stipe center 18.95 8.21 29.68
Pileal_Stipeal_shell Stage I stipe shell 31.21 14.75 47.66
DIF_stipe_center Stage II stipe center 4.24 1.11 7.37
DIF_stipe_shell Stage II stipe shell 2.80 0.52 5.09
DIF_stipe_skin Stage II stipe skin 12.35 3.91 20.78
DIF_cap_skin Stage II cap skin 22.76 9.92 35.60
DIF_cap_tissue Stage II cap tissue 13.34 5.35 21.34
DIF_gill_tissue Stage II gill tissue 19.10 7.67 30.54
YFB_stipe_center Young fruiting body stipe center 3.50 0.73 6.27
YFB_stipe_shell Young fruiting body stipe shell 3.06 0.67 5.45
YFB_stipe_skin Young fruiting body stipe skin 8.07 2.90 13.25
YFB_cap_skin Young fruiting body cap skin 25.02 11.47 38.56
YFB_cap_tissue Young fruiting body cap tissue 1.14 0.00 2.46
YFB_gill_tissue Young fruiting body gill tissue 27.70 11.30 44.09
YFB_veil Young fruiting body veil 19.26 7.97 30.55

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.001625 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.032978 yes
DIF_gill_tissue YFB_cap_skin 0.606857 no
DIF_gill_tissue YFB_cap_tissue 0.002525 yes
DIF_gill_tissue YFB_gill_tissue 0.441224 no
DIF_gill_tissue YFB_veil 0.991241 no
YFB_stipe_center YFB_stipe_shell 0.890791 no
YFB_stipe_center YFB_stipe_skin 0.111334 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.157175 no
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.046327 yes
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.209955 no
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.002525 yes
YFB_stipe_skin YFB_cap_tissue 0.019169 yes
YFB_stipe_skin YFB_gill_tissue 0.001140 yes
YFB_stipe_skin YFB_veil 0.036228 yes
YFB_cap_skin YFB_cap_tissue 0.002084 yes
YFB_cap_skin YFB_gill_tissue 0.881561 no
YFB_cap_skin YFB_veil 0.626078 no
YFB_cap_tissue YFB_gill_tissue 0.001625 yes
YFB_cap_tissue YFB_veil 0.002525 yes
YFB_gill_tissue YFB_veil 0.463231 no
Initials DIF_gill_tissue 0.008457 yes
Initials YFB_stipe_center 0.253793 no
Initials YFB_stipe_shell 0.133562 no
Initials YFB_stipe_skin 0.771411 no
Initials YFB_cap_skin 0.001140 yes
Initials YFB_cap_tissue 0.030610 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.007439 yes
Initials Pileal_Stipeal_center 0.007782 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.458055 no
Initials DIF_stipe_shell 0.113653 no
Initials DIF_stipe_skin 0.203278 no
Initials DIF_cap_skin 0.002084 yes
Initials DIF_cap_tissue 0.109462 no
Pileal_Stipeal_center DIF_gill_tissue 0.991274 no
Pileal_Stipeal_center YFB_stipe_center 0.001625 yes
Pileal_Stipeal_center YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_center YFB_stipe_skin 0.033906 yes
Pileal_Stipeal_center YFB_cap_skin 0.595211 no
Pileal_Stipeal_center YFB_cap_tissue 0.002525 yes
Pileal_Stipeal_center YFB_gill_tissue 0.429462 no
Pileal_Stipeal_center YFB_veil 0.983572 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.221592 no
Pileal_Stipeal_center DIF_stipe_center 0.001140 yes
Pileal_Stipeal_center DIF_stipe_shell 0.001625 yes
Pileal_Stipeal_center DIF_stipe_skin 0.416662 no
Pileal_Stipeal_center DIF_cap_skin 0.770731 no
Pileal_Stipeal_center DIF_cap_tissue 0.503774 no
Pileal_Stipeal_shell DIF_gill_tissue 0.236791 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.676327 no
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.854523 no
Pileal_Stipeal_shell YFB_veil 0.258299 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.027451 yes
Pileal_Stipeal_shell DIF_cap_skin 0.515837 no
Pileal_Stipeal_shell DIF_cap_tissue 0.025711 yes
DIF_stipe_center DIF_gill_tissue 0.001140 yes
DIF_stipe_center YFB_stipe_center 0.832782 no
DIF_stipe_center YFB_stipe_shell 0.668305 no
DIF_stipe_center YFB_stipe_skin 0.223034 no
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.094323 no
DIF_stipe_center YFB_gill_tissue 0.000613 yes
DIF_stipe_center YFB_veil 0.000613 yes
DIF_stipe_center DIF_stipe_shell 0.576559 no
DIF_stipe_center DIF_stipe_skin 0.024444 yes
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.012274 yes
DIF_stipe_shell DIF_gill_tissue 0.001140 yes
DIF_stipe_shell YFB_stipe_center 0.803530 no
DIF_stipe_shell YFB_stipe_shell 0.932959 no
DIF_stipe_shell YFB_stipe_skin 0.043983 yes
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.272049 no
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.001140 yes
DIF_stipe_shell DIF_stipe_skin 0.006032 yes
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.005302 yes
DIF_stipe_skin DIF_gill_tissue 0.401561 no
DIF_stipe_skin YFB_stipe_center 0.011659 yes
DIF_stipe_skin YFB_stipe_shell 0.003365 yes
DIF_stipe_skin YFB_stipe_skin 0.453226 no
DIF_stipe_skin YFB_cap_skin 0.109313 no
DIF_stipe_skin YFB_cap_tissue 0.006032 yes
DIF_stipe_skin YFB_gill_tissue 0.061277 no
DIF_stipe_skin YFB_veil 0.398759 no
DIF_stipe_skin DIF_cap_skin 0.190617 no
DIF_stipe_skin DIF_cap_tissue 0.926693 no
DIF_cap_skin DIF_gill_tissue 0.779633 no
DIF_cap_skin YFB_stipe_center 0.001140 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.007439 yes
DIF_cap_skin YFB_cap_skin 0.893347 no
DIF_cap_skin YFB_cap_tissue 0.002084 yes
DIF_cap_skin YFB_gill_tissue 0.745153 no
DIF_cap_skin YFB_veil 0.797176 no
DIF_cap_skin DIF_cap_tissue 0.228037 no
DIF_cap_tissue DIF_gill_tissue 0.483886 no
DIF_cap_tissue YFB_stipe_center 0.007439 yes
DIF_cap_tissue YFB_stipe_shell 0.001140 yes
DIF_cap_tissue YFB_stipe_skin 0.305970 no
DIF_cap_tissue YFB_cap_skin 0.127489 no
DIF_cap_tissue YFB_cap_tissue 0.005302 yes
DIF_cap_tissue YFB_gill_tissue 0.066767 no
DIF_cap_tissue YFB_veil 0.479263 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|113350
MLSSKLFSLLSFAAAAVAQGFPSGQFFIANVESELVLAVEGGVGGSSPGAFVVLAEQNASDDAQIWSYAEGRGFL
TNNASHLVLEVPRTDGQVNYGTRLELAEPRNEANDDLTQLWDYDGDAQHLFTLADTNACLAANSSVQYAIVDVCD
SQDNDSQQWRFVSV*
Coding >AgabiH97|113350
ATGCTCTCCTCCAAATTATTCTCCCTTCTGAGTTTCGCTGCAGCTGCTGTTGCTCAAGGATTCCCTAGTGGGCAG
TTCTTTATCGCTAACGTCGAGTCTGAACTGGTCTTGGCCGTCGAAGGCGGAGTTGGGGGTTCAAGTCCTGGTGCA
TTCGTTGTCCTCGCAGAACAAAACGCAAGCGATGATGCACAGATCTGGTCATACGCTGAGGGCCGTGGATTCTTG
ACGAACAATGCCTCTCACCTTGTTCTTGAAGTGCCCAGAACAGATGGCCAGGTCAATTATGGAACCAGGCTGGAG
TTAGCAGAGCCCAGGAATGAAGCCAATGACGATTTGACTCAGTTGTGGGACTATGATGGAGACGCACAACATTTG
TTCACACTAGCCGATACTAATGCATGCCTTGCTGCGAATAGCTCAGTGCAGTATGCCATAGTTGACGTTTGTGAC
TCTCAAGATAACGATTCTCAACAGTGGAGATTCGTCAGTGTCTGA
Transcript >AgabiH97|113350
ATGCTCTCCTCCAAATTATTCTCCCTTCTGAGTTTCGCTGCAGCTGCTGTTGCTCAAGGATTCCCTAGTGGGCAG
TTCTTTATCGCTAACGTCGAGTCTGAACTGGTCTTGGCCGTCGAAGGCGGAGTTGGGGGTTCAAGTCCTGGTGCA
TTCGTTGTCCTCGCAGAACAAAACGCAAGCGATGATGCACAGATCTGGTCATACGCTGAGGGCCGTGGATTCTTG
ACGAACAATGCCTCTCACCTTGTTCTTGAAGTGCCCAGAACAGATGGCCAGGTCAATTATGGAACCAGGCTGGAG
TTAGCAGAGCCCAGGAATGAAGCCAATGACGATTTGACTCAGTTGTGGGACTATGATGGAGACGCACAACATTTG
TTCACACTAGCCGATACTAATGCATGCCTTGCTGCGAATAGCTCAGTGCAGTATGCCATAGTTGACGTTTGTGAC
TCTCAAGATAACGATTCTCAACAGTGGAGATTCGTCAGTGTCTGA
Gene >AgabiH97|113350
ATGCTCTCCTCCAAATTATTCTCCCTTCTGAGTTTCGCTGCAGCTGCTGTTGCTCAAGGATTCCCTAGTGGGCAG
TTCTTTATCGCTAACGTCGAGTCTGAACTGGTCTTGGCCGTCGAAGGCGGAGTTGGGGGTTCAAGTGTAGGTGCC
GAATCTGTTCAACCTCTTGTTCGATCATTGACTTATTGTTTAGCCTGGTGCATTCGTTGTCCTCGCAGAACAAAA
CGCAAGCGATGATGCACAGATCTGGTCATACGCTGAGGGCCGTGGATTCTTGACGAACAATGCCTCTCACCTTGT
TCTTGAAGTGCCCAGTGAGTTGCAGCTGCGTACTTATTTGTCCGTTTGGGTGGCGTGAACTTTCTTCTTTTAATA
GGAACAGATGGCCAGGTCAATTATGGAACCAGGCTGGAGTTAGCAGAGCCCAGGAATGAAGCCAATGACGATTTG
ACTCAGTTGTGGGACTATGATGGAGACGCACAACATTTGTTCACACTAGCCGATACTAATGCATGCCTTGCTGCG
AATAGCTCAGTGCAGTATGCCATAGTTGACGTTTGTGACTCTCAAGATAACGATTCTCAACAGTGGAGATTCGTC
AGTGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail