Protein ID | AgabiH97|113350 |
Gene name | |
Location | scaffold_8:1896680..1897289 |
Strand | + |
Gene length (bp) | 609 |
Transcript length (bp) | 495 |
Coding sequence length (bp) | 495 |
Protein length (aa) | 165 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
Yes | 1 - 19 | 0.45 |
Expression values
Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
---|---|---|---|---|
Casing | Casing mycelium | 301.50 | 141.74 | 461.25 |
Initials | Initials knots | 6.59 | 2.22 | 10.95 |
Pileal_Stipeal_center | Stage I stipe center | 18.95 | 8.21 | 29.68 |
Pileal_Stipeal_shell | Stage I stipe shell | 31.21 | 14.75 | 47.66 |
DIF_stipe_center | Stage II stipe center | 4.24 | 1.11 | 7.37 |
DIF_stipe_shell | Stage II stipe shell | 2.80 | 0.52 | 5.09 |
DIF_stipe_skin | Stage II stipe skin | 12.35 | 3.91 | 20.78 |
DIF_cap_skin | Stage II cap skin | 22.76 | 9.92 | 35.60 |
DIF_cap_tissue | Stage II cap tissue | 13.34 | 5.35 | 21.34 |
DIF_gill_tissue | Stage II gill tissue | 19.10 | 7.67 | 30.54 |
YFB_stipe_center | Young fruiting body stipe center | 3.50 | 0.73 | 6.27 |
YFB_stipe_shell | Young fruiting body stipe shell | 3.06 | 0.67 | 5.45 |
YFB_stipe_skin | Young fruiting body stipe skin | 8.07 | 2.90 | 13.25 |
YFB_cap_skin | Young fruiting body cap skin | 25.02 | 11.47 | 38.56 |
YFB_cap_tissue | Young fruiting body cap tissue | 1.14 | 0.00 | 2.46 |
YFB_gill_tissue | Young fruiting body gill tissue | 27.70 | 11.30 | 44.09 |
YFB_veil | Young fruiting body veil | 19.26 | 7.97 | 30.55 |
Differential expression
Label1 | Label2 | Q-value | Significant difference |
---|---|---|---|
Casing | DIF_gill_tissue | 0.000613 | yes |
Casing | YFB_stipe_center | 0.000613 | yes |
Casing | YFB_stipe_shell | 0.000613 | yes |
Casing | YFB_stipe_skin | 0.000613 | yes |
Casing | YFB_cap_skin | 0.000613 | yes |
Casing | YFB_cap_tissue | 0.000613 | yes |
Casing | YFB_gill_tissue | 0.000613 | yes |
Casing | YFB_veil | 0.000613 | yes |
Casing | Initials | 0.000613 | yes |
Casing | Pileal_Stipeal_center | 0.000613 | yes |
Casing | Pileal_Stipeal_shell | 0.000613 | yes |
Casing | DIF_stipe_center | 0.000613 | yes |
Casing | DIF_stipe_shell | 0.000613 | yes |
Casing | DIF_stipe_skin | 0.000613 | yes |
Casing | DIF_cap_skin | 0.000613 | yes |
Casing | DIF_cap_tissue | 0.000613 | yes |
DIF_gill_tissue | YFB_stipe_center | 0.001625 | yes |
DIF_gill_tissue | YFB_stipe_shell | 0.000613 | yes |
DIF_gill_tissue | YFB_stipe_skin | 0.032978 | yes |
DIF_gill_tissue | YFB_cap_skin | 0.606857 | no |
DIF_gill_tissue | YFB_cap_tissue | 0.002525 | yes |
DIF_gill_tissue | YFB_gill_tissue | 0.441224 | no |
DIF_gill_tissue | YFB_veil | 0.991241 | no |
YFB_stipe_center | YFB_stipe_shell | 0.890791 | no |
YFB_stipe_center | YFB_stipe_skin | 0.111334 | no |
YFB_stipe_center | YFB_cap_skin | 0.000613 | yes |
YFB_stipe_center | YFB_cap_tissue | 0.157175 | no |
YFB_stipe_center | YFB_gill_tissue | 0.000613 | yes |
YFB_stipe_center | YFB_veil | 0.000613 | yes |
YFB_stipe_shell | YFB_stipe_skin | 0.046327 | yes |
YFB_stipe_shell | YFB_cap_skin | 0.000613 | yes |
YFB_stipe_shell | YFB_cap_tissue | 0.209955 | no |
YFB_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
YFB_stipe_shell | YFB_veil | 0.000613 | yes |
YFB_stipe_skin | YFB_cap_skin | 0.002525 | yes |
YFB_stipe_skin | YFB_cap_tissue | 0.019169 | yes |
YFB_stipe_skin | YFB_gill_tissue | 0.001140 | yes |
YFB_stipe_skin | YFB_veil | 0.036228 | yes |
YFB_cap_skin | YFB_cap_tissue | 0.002084 | yes |
YFB_cap_skin | YFB_gill_tissue | 0.881561 | no |
YFB_cap_skin | YFB_veil | 0.626078 | no |
YFB_cap_tissue | YFB_gill_tissue | 0.001625 | yes |
YFB_cap_tissue | YFB_veil | 0.002525 | yes |
YFB_gill_tissue | YFB_veil | 0.463231 | no |
Initials | DIF_gill_tissue | 0.008457 | yes |
Initials | YFB_stipe_center | 0.253793 | no |
Initials | YFB_stipe_shell | 0.133562 | no |
Initials | YFB_stipe_skin | 0.771411 | no |
Initials | YFB_cap_skin | 0.001140 | yes |
Initials | YFB_cap_tissue | 0.030610 | yes |
Initials | YFB_gill_tissue | 0.000613 | yes |
Initials | YFB_veil | 0.007439 | yes |
Initials | Pileal_Stipeal_center | 0.007782 | yes |
Initials | Pileal_Stipeal_shell | 0.000613 | yes |
Initials | DIF_stipe_center | 0.458055 | no |
Initials | DIF_stipe_shell | 0.113653 | no |
Initials | DIF_stipe_skin | 0.203278 | no |
Initials | DIF_cap_skin | 0.002084 | yes |
Initials | DIF_cap_tissue | 0.109462 | no |
Pileal_Stipeal_center | DIF_gill_tissue | 0.991274 | no |
Pileal_Stipeal_center | YFB_stipe_center | 0.001625 | yes |
Pileal_Stipeal_center | YFB_stipe_shell | 0.000613 | yes |
Pileal_Stipeal_center | YFB_stipe_skin | 0.033906 | yes |
Pileal_Stipeal_center | YFB_cap_skin | 0.595211 | no |
Pileal_Stipeal_center | YFB_cap_tissue | 0.002525 | yes |
Pileal_Stipeal_center | YFB_gill_tissue | 0.429462 | no |
Pileal_Stipeal_center | YFB_veil | 0.983572 | no |
Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.221592 | no |
Pileal_Stipeal_center | DIF_stipe_center | 0.001140 | yes |
Pileal_Stipeal_center | DIF_stipe_shell | 0.001625 | yes |
Pileal_Stipeal_center | DIF_stipe_skin | 0.416662 | no |
Pileal_Stipeal_center | DIF_cap_skin | 0.770731 | no |
Pileal_Stipeal_center | DIF_cap_tissue | 0.503774 | no |
Pileal_Stipeal_shell | DIF_gill_tissue | 0.236791 | no |
Pileal_Stipeal_shell | YFB_stipe_center | 0.000613 | yes |
Pileal_Stipeal_shell | YFB_stipe_shell | 0.000613 | yes |
Pileal_Stipeal_shell | YFB_stipe_skin | 0.000613 | yes |
Pileal_Stipeal_shell | YFB_cap_skin | 0.676327 | no |
Pileal_Stipeal_shell | YFB_cap_tissue | 0.000613 | yes |
Pileal_Stipeal_shell | YFB_gill_tissue | 0.854523 | no |
Pileal_Stipeal_shell | YFB_veil | 0.258299 | no |
Pileal_Stipeal_shell | DIF_stipe_center | 0.000613 | yes |
Pileal_Stipeal_shell | DIF_stipe_shell | 0.000613 | yes |
Pileal_Stipeal_shell | DIF_stipe_skin | 0.027451 | yes |
Pileal_Stipeal_shell | DIF_cap_skin | 0.515837 | no |
Pileal_Stipeal_shell | DIF_cap_tissue | 0.025711 | yes |
DIF_stipe_center | DIF_gill_tissue | 0.001140 | yes |
DIF_stipe_center | YFB_stipe_center | 0.832782 | no |
DIF_stipe_center | YFB_stipe_shell | 0.668305 | no |
DIF_stipe_center | YFB_stipe_skin | 0.223034 | no |
DIF_stipe_center | YFB_cap_skin | 0.000613 | yes |
DIF_stipe_center | YFB_cap_tissue | 0.094323 | no |
DIF_stipe_center | YFB_gill_tissue | 0.000613 | yes |
DIF_stipe_center | YFB_veil | 0.000613 | yes |
DIF_stipe_center | DIF_stipe_shell | 0.576559 | no |
DIF_stipe_center | DIF_stipe_skin | 0.024444 | yes |
DIF_stipe_center | DIF_cap_skin | 0.000613 | yes |
DIF_stipe_center | DIF_cap_tissue | 0.012274 | yes |
DIF_stipe_shell | DIF_gill_tissue | 0.001140 | yes |
DIF_stipe_shell | YFB_stipe_center | 0.803530 | no |
DIF_stipe_shell | YFB_stipe_shell | 0.932959 | no |
DIF_stipe_shell | YFB_stipe_skin | 0.043983 | yes |
DIF_stipe_shell | YFB_cap_skin | 0.000613 | yes |
DIF_stipe_shell | YFB_cap_tissue | 0.272049 | no |
DIF_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
DIF_stipe_shell | YFB_veil | 0.001140 | yes |
DIF_stipe_shell | DIF_stipe_skin | 0.006032 | yes |
DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
DIF_stipe_shell | DIF_cap_tissue | 0.005302 | yes |
DIF_stipe_skin | DIF_gill_tissue | 0.401561 | no |
DIF_stipe_skin | YFB_stipe_center | 0.011659 | yes |
DIF_stipe_skin | YFB_stipe_shell | 0.003365 | yes |
DIF_stipe_skin | YFB_stipe_skin | 0.453226 | no |
DIF_stipe_skin | YFB_cap_skin | 0.109313 | no |
DIF_stipe_skin | YFB_cap_tissue | 0.006032 | yes |
DIF_stipe_skin | YFB_gill_tissue | 0.061277 | no |
DIF_stipe_skin | YFB_veil | 0.398759 | no |
DIF_stipe_skin | DIF_cap_skin | 0.190617 | no |
DIF_stipe_skin | DIF_cap_tissue | 0.926693 | no |
DIF_cap_skin | DIF_gill_tissue | 0.779633 | no |
DIF_cap_skin | YFB_stipe_center | 0.001140 | yes |
DIF_cap_skin | YFB_stipe_shell | 0.000613 | yes |
DIF_cap_skin | YFB_stipe_skin | 0.007439 | yes |
DIF_cap_skin | YFB_cap_skin | 0.893347 | no |
DIF_cap_skin | YFB_cap_tissue | 0.002084 | yes |
DIF_cap_skin | YFB_gill_tissue | 0.745153 | no |
DIF_cap_skin | YFB_veil | 0.797176 | no |
DIF_cap_skin | DIF_cap_tissue | 0.228037 | no |
DIF_cap_tissue | DIF_gill_tissue | 0.483886 | no |
DIF_cap_tissue | YFB_stipe_center | 0.007439 | yes |
DIF_cap_tissue | YFB_stipe_shell | 0.001140 | yes |
DIF_cap_tissue | YFB_stipe_skin | 0.305970 | no |
DIF_cap_tissue | YFB_cap_skin | 0.127489 | no |
DIF_cap_tissue | YFB_cap_tissue | 0.005302 | yes |
DIF_cap_tissue | YFB_gill_tissue | 0.066767 | no |
DIF_cap_tissue | YFB_veil | 0.479263 | no |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|113350 MLSSKLFSLLSFAAAAVAQGFPSGQFFIANVESELVLAVEGGVGGSSPGAFVVLAEQNASDDAQIWSYAEGRGFL TNNASHLVLEVPRTDGQVNYGTRLELAEPRNEANDDLTQLWDYDGDAQHLFTLADTNACLAANSSVQYAIVDVCD SQDNDSQQWRFVSV* |
Coding | >AgabiH97|113350 ATGCTCTCCTCCAAATTATTCTCCCTTCTGAGTTTCGCTGCAGCTGCTGTTGCTCAAGGATTCCCTAGTGGGCAG TTCTTTATCGCTAACGTCGAGTCTGAACTGGTCTTGGCCGTCGAAGGCGGAGTTGGGGGTTCAAGTCCTGGTGCA TTCGTTGTCCTCGCAGAACAAAACGCAAGCGATGATGCACAGATCTGGTCATACGCTGAGGGCCGTGGATTCTTG ACGAACAATGCCTCTCACCTTGTTCTTGAAGTGCCCAGAACAGATGGCCAGGTCAATTATGGAACCAGGCTGGAG TTAGCAGAGCCCAGGAATGAAGCCAATGACGATTTGACTCAGTTGTGGGACTATGATGGAGACGCACAACATTTG TTCACACTAGCCGATACTAATGCATGCCTTGCTGCGAATAGCTCAGTGCAGTATGCCATAGTTGACGTTTGTGAC TCTCAAGATAACGATTCTCAACAGTGGAGATTCGTCAGTGTCTGA |
Transcript | >AgabiH97|113350 ATGCTCTCCTCCAAATTATTCTCCCTTCTGAGTTTCGCTGCAGCTGCTGTTGCTCAAGGATTCCCTAGTGGGCAG TTCTTTATCGCTAACGTCGAGTCTGAACTGGTCTTGGCCGTCGAAGGCGGAGTTGGGGGTTCAAGTCCTGGTGCA TTCGTTGTCCTCGCAGAACAAAACGCAAGCGATGATGCACAGATCTGGTCATACGCTGAGGGCCGTGGATTCTTG ACGAACAATGCCTCTCACCTTGTTCTTGAAGTGCCCAGAACAGATGGCCAGGTCAATTATGGAACCAGGCTGGAG TTAGCAGAGCCCAGGAATGAAGCCAATGACGATTTGACTCAGTTGTGGGACTATGATGGAGACGCACAACATTTG TTCACACTAGCCGATACTAATGCATGCCTTGCTGCGAATAGCTCAGTGCAGTATGCCATAGTTGACGTTTGTGAC TCTCAAGATAACGATTCTCAACAGTGGAGATTCGTCAGTGTCTGA |
Gene | >AgabiH97|113350 ATGCTCTCCTCCAAATTATTCTCCCTTCTGAGTTTCGCTGCAGCTGCTGTTGCTCAAGGATTCCCTAGTGGGCAG TTCTTTATCGCTAACGTCGAGTCTGAACTGGTCTTGGCCGTCGAAGGCGGAGTTGGGGGTTCAAGTGTAGGTGCC GAATCTGTTCAACCTCTTGTTCGATCATTGACTTATTGTTTAGCCTGGTGCATTCGTTGTCCTCGCAGAACAAAA CGCAAGCGATGATGCACAGATCTGGTCATACGCTGAGGGCCGTGGATTCTTGACGAACAATGCCTCTCACCTTGT TCTTGAAGTGCCCAGTGAGTTGCAGCTGCGTACTTATTTGTCCGTTTGGGTGGCGTGAACTTTCTTCTTTTAATA GGAACAGATGGCCAGGTCAATTATGGAACCAGGCTGGAGTTAGCAGAGCCCAGGAATGAAGCCAATGACGATTTG ACTCAGTTGTGGGACTATGATGGAGACGCACAACATTTGTTCACACTAGCCGATACTAATGCATGCCTTGCTGCG AATAGCTCAGTGCAGTATGCCATAGTTGACGTTTGTGACTCTCAAGATAACGATTCTCAACAGTGGAGATTCGTC AGTGTCTGA |