Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|112920
Gene name
Locationscaffold_8:1791492..1792019
Strand+
Gene length (bp)527
Transcript length (bp)273
Coding sequence length (bp)273
Protein length (aa) 91

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 131.87 39.48 224.26
Initials Initials knots 289.18 150.83 427.54
Pileal_Stipeal_center Stage I stipe center 879.67 514.13 1245.20
Pileal_Stipeal_shell Stage I stipe shell 393.09 212.25 573.94
DIF_stipe_center Stage II stipe center 2209.11 1310.74 3107.48
DIF_stipe_shell Stage II stipe shell 531.26 293.10 769.42
DIF_stipe_skin Stage II stipe skin 313.71 159.78 467.64
DIF_cap_skin Stage II cap skin 5.00 0.00 10.22
DIF_cap_tissue Stage II cap tissue 100.02 31.02 169.02
DIF_gill_tissue Stage II gill tissue 812.42 457.91 1166.94
YFB_stipe_center Young fruiting body stipe center 610.05 348.57 871.54
YFB_stipe_shell Young fruiting body stipe shell 554.40 311.43 797.36
YFB_stipe_skin Young fruiting body stipe skin 587.17 328.60 845.75
YFB_cap_skin Young fruiting body cap skin 2.65 0.00 6.18
YFB_cap_tissue Young fruiting body cap tissue 6.24 0.15 12.32
YFB_gill_tissue Young fruiting body gill tissue 149.02 59.46 238.59
YFB_veil Young fruiting body veil 191.61 72.12 311.10

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.006742 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.878268 no
Casing YFB_veil 0.527187 no
Casing Initials 0.071413 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.008121 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.041603 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.703809 no
DIF_gill_tissue YFB_stipe_center 0.422501 no
DIF_gill_tissue YFB_stipe_shell 0.249200 no
DIF_gill_tissue YFB_stipe_skin 0.358145 no
DIF_gill_tissue YFB_cap_skin 0.006742 yes
DIF_gill_tissue YFB_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_gill_tissue 0.000613 yes
DIF_gill_tissue YFB_veil 0.000613 yes
YFB_stipe_center YFB_stipe_shell 0.853643 no
YFB_stipe_center YFB_stipe_skin 0.946665 no
YFB_stipe_center YFB_cap_skin 0.006742 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.001625 yes
YFB_stipe_shell YFB_stipe_skin 0.921871 no
YFB_stipe_shell YFB_cap_skin 0.006742 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.002084 yes
YFB_stipe_skin YFB_cap_skin 0.006742 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.001625 yes
YFB_cap_skin YFB_cap_tissue 0.370347 no
YFB_cap_skin YFB_gill_tissue 0.006387 yes
YFB_cap_skin YFB_veil 0.006387 yes
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.667984 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.009446 yes
Initials YFB_stipe_shell 0.024698 yes
Initials YFB_stipe_skin 0.014668 yes
Initials YFB_cap_skin 0.006742 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.067706 no
Initials YFB_veil 0.336508 no
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.425607 no
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.047584 yes
Initials DIF_stipe_skin 0.891989 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.012880 yes
Pileal_Stipeal_center DIF_gill_tissue 0.879521 no
Pileal_Stipeal_center YFB_stipe_center 0.253894 no
Pileal_Stipeal_center YFB_stipe_shell 0.124266 no
Pileal_Stipeal_center YFB_stipe_skin 0.204470 no
Pileal_Stipeal_center YFB_cap_skin 0.006742 yes
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_veil 0.000613 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.002525 yes
Pileal_Stipeal_center DIF_stipe_center 0.000613 yes
Pileal_Stipeal_center DIF_stipe_shell 0.087927 no
Pileal_Stipeal_center DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.009773 yes
Pileal_Stipeal_shell YFB_stipe_center 0.171663 no
Pileal_Stipeal_shell YFB_stipe_shell 0.342473 no
Pileal_Stipeal_shell YFB_stipe_skin 0.241805 no
Pileal_Stipeal_shell YFB_cap_skin 0.006742 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.004548 yes
Pileal_Stipeal_shell YFB_veil 0.050706 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.430760 no
Pileal_Stipeal_shell DIF_stipe_skin 0.613651 no
Pileal_Stipeal_shell DIF_cap_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_tissue 0.001625 yes
DIF_stipe_center DIF_gill_tissue 0.000613 yes
DIF_stipe_center YFB_stipe_center 0.000613 yes
DIF_stipe_center YFB_stipe_shell 0.000613 yes
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.006742 yes
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.000613 yes
DIF_stipe_center YFB_veil 0.000613 yes
DIF_stipe_center DIF_stipe_shell 0.000613 yes
DIF_stipe_center DIF_stipe_skin 0.000613 yes
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.189511 no
DIF_stipe_shell YFB_stipe_center 0.768767 no
DIF_stipe_shell YFB_stipe_shell 0.943484 no
DIF_stipe_shell YFB_stipe_skin 0.849889 no
DIF_stipe_shell YFB_cap_skin 0.006742 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.003765 yes
DIF_stipe_shell DIF_stipe_skin 0.107603 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_stipe_center 0.028437 yes
DIF_stipe_skin YFB_stipe_shell 0.070862 no
DIF_stipe_skin YFB_stipe_skin 0.043555 yes
DIF_stipe_skin YFB_cap_skin 0.006742 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.040058 yes
DIF_stipe_skin YFB_veil 0.238109 no
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.008121 yes
DIF_cap_skin DIF_gill_tissue 0.000613 yes
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.561375 no
DIF_cap_skin YFB_cap_tissue 0.857226 no
DIF_cap_skin YFB_gill_tissue 0.000613 yes
DIF_cap_skin YFB_veil 0.000613 yes
DIF_cap_skin DIF_cap_tissue 0.000613 yes
DIF_cap_tissue DIF_gill_tissue 0.000613 yes
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.006742 yes
DIF_cap_tissue YFB_cap_tissue 0.000613 yes
DIF_cap_tissue YFB_gill_tissue 0.471837 no
DIF_cap_tissue YFB_veil 0.175423 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|112920
MRSLTFFALIASVLAATVTAVPLENSNLPGRDVDLETSATPGAPGWKRSEQGPGAPGWKRSEQGPGAPGWKRKEQ
GPGAPGWKRTEDTPA*
Coding >AgabiH97|112920
ATGCGTTCTTTGACTTTTTTTGCTCTGATTGCTTCCGTTCTTGCGGCCACGGTCACTGCTGTGCCTCTGGAGAAC
TCGAATCTCCCCGGTCGTGATGTAGACTTGGAGACGTCAGCTACTCCTGGTGCCCCTGGTTGGAAGCGCAGTGAA
CAGGGTCCAGGCGCTCCTGGGTGGAAGCGCAGTGAACAAGGTCCAGGCGCTCCGGGGTGGAAGCGTAAGGAACAG
GGTCCTGGTGCTCCTGGTTGGAAGCGCACTGAGGACACTCCTGCCTAA
Transcript >AgabiH97|112920
ATGCGTTCTTTGACTTTTTTTGCTCTGATTGCTTCCGTTCTTGCGGCCACGGTCACTGCTGTGCCTCTGGAGAAC
TCGAATCTCCCCGGTCGTGATGTAGACTTGGAGACGTCAGCTACTCCTGGTGCCCCTGGTTGGAAGCGCAGTGAA
CAGGGTCCAGGCGCTCCTGGGTGGAAGCGCAGTGAACAAGGTCCAGGCGCTCCGGGGTGGAAGCGTAAGGAACAG
GGTCCTGGTGCTCCTGGTTGGAAGCGCACTGAGGACACTCCTGCCTAA
Gene >AgabiH97|112920
ATGCGTTCTTTGACTTTTTTTGCTCTGATTGCTTCCGTTCTTGCGGCCACGGTCACTGCTGTGCCTCTGGTATGT
TAGATCTTTGAATCCTTCTATTTTGCCCTTCGTTTACCCTACCCGTAGGAGAACTCGAATCTCCCCGGTCGTGAT
GTAGACTTGGAGACGTCAGCTACTGTTGGTTTATTTTTCTCTCCGGCGCCTTATCTATTTAATCACATTCGTGCC
CTCAGCCTGGTGCCCCTGGTTGGAAGCGCAGTGAACAGGGTCCAGGCGCTCCTGGGTGGAAGCGCAGTGAACAAG
GTCCCGGTGCTCCAGGGTGGAAGCGCAAAGAACAAGGTCCAGGTGCTCCAGGGTGGAAACGCGAAGAACAAGGTC
CAGGTGCTCCTGGATGGAAGCGCAAAGAGCAAGGTCCGGGTGCTCCTGGTTGGAAACGCAGTGAACAAGGTCCAG
GCGCTCCGGGGTGGAAGCGTAAGGAACAGGGTCCTGGTGCTCCTGGTTGGAAGCGCACTGAGGACACTCCTGCCT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail