© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|112920 |
| Gene name | |
| Location | scaffold_8:1791492..1792019 |
| Strand | + |
| Gene length (bp) | 527 |
| Transcript length (bp) | 273 |
| Coding sequence length (bp) | 273 |
| Protein length (aa) | 91 |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Extracellular | Signal peptide | 0.0661 | 0.0433 | 0.983 | 0.0291 | 0.063 | 0.0036 | 0.0682 | 0.0322 | 0.0739 | 0.0017 |
| SignalP signal predicted | Location | Score |
|---|---|---|
| Yes | 1 - 20 | 0.999721 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 131.87 | 39.48 | 224.26 |
| Initials | Initials knots | 289.18 | 150.83 | 427.54 |
| Pileal_Stipeal_center | Stage I stipe center | 879.67 | 514.13 | 1245.20 |
| Pileal_Stipeal_shell | Stage I stipe shell | 393.09 | 212.25 | 573.94 |
| DIF_stipe_center | Stage II stipe center | 2209.11 | 1310.74 | 3107.48 |
| DIF_stipe_shell | Stage II stipe shell | 531.26 | 293.10 | 769.42 |
| DIF_stipe_skin | Stage II stipe skin | 313.71 | 159.78 | 467.64 |
| DIF_cap_skin | Stage II cap skin | 5.00 | 0.00 | 10.22 |
| DIF_cap_tissue | Stage II cap tissue | 100.02 | 31.02 | 169.02 |
| DIF_gill_tissue | Stage II gill tissue | 812.42 | 457.91 | 1166.94 |
| YFB_stipe_center | Young fruiting body stipe center | 610.05 | 348.57 | 871.54 |
| YFB_stipe_shell | Young fruiting body stipe shell | 554.40 | 311.43 | 797.36 |
| YFB_stipe_skin | Young fruiting body stipe skin | 587.17 | 328.60 | 845.75 |
| YFB_cap_skin | Young fruiting body cap skin | 2.65 | 0.00 | 6.18 |
| YFB_cap_tissue | Young fruiting body cap tissue | 6.24 | 0.15 | 12.32 |
| YFB_gill_tissue | Young fruiting body gill tissue | 149.02 | 59.46 | 238.59 |
| YFB_veil | Young fruiting body veil | 191.61 | 72.12 | 311.10 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.000613 | yes |
| Casing | YFB_stipe_center | 0.000613 | yes |
| Casing | YFB_stipe_shell | 0.000613 | yes |
| Casing | YFB_stipe_skin | 0.000613 | yes |
| Casing | YFB_cap_skin | 0.006742 | yes |
| Casing | YFB_cap_tissue | 0.000613 | yes |
| Casing | YFB_gill_tissue | 0.878268 | no |
| Casing | YFB_veil | 0.527187 | no |
| Casing | Initials | 0.071413 | no |
| Casing | Pileal_Stipeal_center | 0.000613 | yes |
| Casing | Pileal_Stipeal_shell | 0.008121 | yes |
| Casing | DIF_stipe_center | 0.000613 | yes |
| Casing | DIF_stipe_shell | 0.000613 | yes |
| Casing | DIF_stipe_skin | 0.041603 | yes |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.703809 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.422501 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.249200 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.358145 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.006742 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_gill_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_veil | 0.000613 | yes |
| YFB_stipe_center | YFB_stipe_shell | 0.853643 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.946665 | no |
| YFB_stipe_center | YFB_cap_skin | 0.006742 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_veil | 0.001625 | yes |
| YFB_stipe_shell | YFB_stipe_skin | 0.921871 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.006742 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_veil | 0.002084 | yes |
| YFB_stipe_skin | YFB_cap_skin | 0.006742 | yes |
| YFB_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_veil | 0.001625 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.370347 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.006387 | yes |
| YFB_cap_skin | YFB_veil | 0.006387 | yes |
| YFB_cap_tissue | YFB_gill_tissue | 0.000613 | yes |
| YFB_cap_tissue | YFB_veil | 0.000613 | yes |
| YFB_gill_tissue | YFB_veil | 0.667984 | no |
| Initials | DIF_gill_tissue | 0.000613 | yes |
| Initials | YFB_stipe_center | 0.009446 | yes |
| Initials | YFB_stipe_shell | 0.024698 | yes |
| Initials | YFB_stipe_skin | 0.014668 | yes |
| Initials | YFB_cap_skin | 0.006742 | yes |
| Initials | YFB_cap_tissue | 0.000613 | yes |
| Initials | YFB_gill_tissue | 0.067706 | no |
| Initials | YFB_veil | 0.336508 | no |
| Initials | Pileal_Stipeal_center | 0.000613 | yes |
| Initials | Pileal_Stipeal_shell | 0.425607 | no |
| Initials | DIF_stipe_center | 0.000613 | yes |
| Initials | DIF_stipe_shell | 0.047584 | yes |
| Initials | DIF_stipe_skin | 0.891989 | no |
| Initials | DIF_cap_skin | 0.000613 | yes |
| Initials | DIF_cap_tissue | 0.012880 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.879521 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.253894 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.124266 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.204470 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.006742 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_veil | 0.000613 | yes |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.002525 | yes |
| Pileal_Stipeal_center | DIF_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.087927 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.009773 | yes |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.171663 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.342473 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.241805 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.006742 | yes |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.004548 | yes |
| Pileal_Stipeal_shell | YFB_veil | 0.050706 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.430760 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.613651 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.001625 | yes |
| DIF_stipe_center | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_stipe_center | 0.000613 | yes |
| DIF_stipe_center | YFB_stipe_shell | 0.000613 | yes |
| DIF_stipe_center | YFB_stipe_skin | 0.000613 | yes |
| DIF_stipe_center | YFB_cap_skin | 0.006742 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_veil | 0.000613 | yes |
| DIF_stipe_center | DIF_stipe_shell | 0.000613 | yes |
| DIF_stipe_center | DIF_stipe_skin | 0.000613 | yes |
| DIF_stipe_center | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | DIF_gill_tissue | 0.189511 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.768767 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.943484 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.849889 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.006742 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_veil | 0.003765 | yes |
| DIF_stipe_shell | DIF_stipe_skin | 0.107603 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.028437 | yes |
| DIF_stipe_skin | YFB_stipe_shell | 0.070862 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.043555 | yes |
| DIF_stipe_skin | YFB_cap_skin | 0.006742 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_gill_tissue | 0.040058 | yes |
| DIF_stipe_skin | YFB_veil | 0.238109 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.008121 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.561375 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.857226 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.000613 | yes |
| DIF_cap_skin | YFB_veil | 0.000613 | yes |
| DIF_cap_skin | DIF_cap_tissue | 0.000613 | yes |
| DIF_cap_tissue | DIF_gill_tissue | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.006742 | yes |
| DIF_cap_tissue | YFB_cap_tissue | 0.000613 | yes |
| DIF_cap_tissue | YFB_gill_tissue | 0.471837 | no |
| DIF_cap_tissue | YFB_veil | 0.175423 | no |
| Orthofinder run ID | 1 |
| Orthogroup | 13434 |
| Change Orthofinder run |
| Species | Protein ID |
|---|---|
| Agaricus bisporus var bisporus H39 | AgabiH39|453700 |
| Agaricus bisporus var bisporus H97 | AgabiH97|112920 (this protein) |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|112920 MRSLTFFALIASVLAATVTAVPLENSNLPGRDVDLETSATPGAPGWKRSEQGPGAPGWKRSEQGPGAPGWKRKEQ GPGAPGWKRTEDTPA* |
| Coding | >AgabiH97|112920 ATGCGTTCTTTGACTTTTTTTGCTCTGATTGCTTCCGTTCTTGCGGCCACGGTCACTGCTGTGCCTCTGGAGAAC TCGAATCTCCCCGGTCGTGATGTAGACTTGGAGACGTCAGCTACTCCTGGTGCCCCTGGTTGGAAGCGCAGTGAA CAGGGTCCAGGCGCTCCTGGGTGGAAGCGCAGTGAACAAGGTCCAGGCGCTCCGGGGTGGAAGCGTAAGGAACAG GGTCCTGGTGCTCCTGGTTGGAAGCGCACTGAGGACACTCCTGCCTAA |
| Transcript | >AgabiH97|112920 ATGCGTTCTTTGACTTTTTTTGCTCTGATTGCTTCCGTTCTTGCGGCCACGGTCACTGCTGTGCCTCTGGAGAAC TCGAATCTCCCCGGTCGTGATGTAGACTTGGAGACGTCAGCTACTCCTGGTGCCCCTGGTTGGAAGCGCAGTGAA CAGGGTCCAGGCGCTCCTGGGTGGAAGCGCAGTGAACAAGGTCCAGGCGCTCCGGGGTGGAAGCGTAAGGAACAG GGTCCTGGTGCTCCTGGTTGGAAGCGCACTGAGGACACTCCTGCCTAA |
| Gene | >AgabiH97|112920 ATGCGTTCTTTGACTTTTTTTGCTCTGATTGCTTCCGTTCTTGCGGCCACGGTCACTGCTGTGCCTCTGGTATGT TAGATCTTTGAATCCTTCTATTTTGCCCTTCGTTTACCCTACCCGTAGGAGAACTCGAATCTCCCCGGTCGTGAT GTAGACTTGGAGACGTCAGCTACTGTTGGTTTATTTTTCTCTCCGGCGCCTTATCTATTTAATCACATTCGTGCC CTCAGCCTGGTGCCCCTGGTTGGAAGCGCAGTGAACAGGGTCCAGGCGCTCCTGGGTGGAAGCGCAGTGAACAAG GTCCCGGTGCTCCAGGGTGGAAGCGCAAAGAACAAGGTCCAGGTGCTCCAGGGTGGAAACGCGAAGAACAAGGTC CAGGTGCTCCTGGATGGAAGCGCAAAGAGCAAGGTCCGGGTGCTCCTGGTTGGAAACGCAGTGAACAAGGTCCAG GCGCTCCGGGGTGGAAGCGTAAGGAACAGGGTCCTGGTGCTCCTGGTTGGAAGCGCACTGAGGACACTCCTGCCT AA |