Protein ID | AgabiH97|112920 |
Gene name | |
Location | scaffold_8:1791492..1792019 |
Strand | + |
Gene length (bp) | 527 |
Transcript length (bp) | 273 |
Coding sequence length (bp) | 273 |
Protein length (aa) | 91 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
Yes | 1 - 21 | 0.45 |
Expression values
Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
---|---|---|---|---|
Casing | Casing mycelium | 131.87 | 39.48 | 224.26 |
Initials | Initials knots | 289.18 | 150.83 | 427.54 |
Pileal_Stipeal_center | Stage I stipe center | 879.67 | 514.13 | 1245.20 |
Pileal_Stipeal_shell | Stage I stipe shell | 393.09 | 212.25 | 573.94 |
DIF_stipe_center | Stage II stipe center | 2209.11 | 1310.74 | 3107.48 |
DIF_stipe_shell | Stage II stipe shell | 531.26 | 293.10 | 769.42 |
DIF_stipe_skin | Stage II stipe skin | 313.71 | 159.78 | 467.64 |
DIF_cap_skin | Stage II cap skin | 5.00 | 0.00 | 10.22 |
DIF_cap_tissue | Stage II cap tissue | 100.02 | 31.02 | 169.02 |
DIF_gill_tissue | Stage II gill tissue | 812.42 | 457.91 | 1166.94 |
YFB_stipe_center | Young fruiting body stipe center | 610.05 | 348.57 | 871.54 |
YFB_stipe_shell | Young fruiting body stipe shell | 554.40 | 311.43 | 797.36 |
YFB_stipe_skin | Young fruiting body stipe skin | 587.17 | 328.60 | 845.75 |
YFB_cap_skin | Young fruiting body cap skin | 2.65 | 0.00 | 6.18 |
YFB_cap_tissue | Young fruiting body cap tissue | 6.24 | 0.15 | 12.32 |
YFB_gill_tissue | Young fruiting body gill tissue | 149.02 | 59.46 | 238.59 |
YFB_veil | Young fruiting body veil | 191.61 | 72.12 | 311.10 |
Differential expression
Label1 | Label2 | Q-value | Significant difference |
---|---|---|---|
Casing | DIF_gill_tissue | 0.000613 | yes |
Casing | YFB_stipe_center | 0.000613 | yes |
Casing | YFB_stipe_shell | 0.000613 | yes |
Casing | YFB_stipe_skin | 0.000613 | yes |
Casing | YFB_cap_skin | 0.006742 | yes |
Casing | YFB_cap_tissue | 0.000613 | yes |
Casing | YFB_gill_tissue | 0.878268 | no |
Casing | YFB_veil | 0.527187 | no |
Casing | Initials | 0.071413 | no |
Casing | Pileal_Stipeal_center | 0.000613 | yes |
Casing | Pileal_Stipeal_shell | 0.008121 | yes |
Casing | DIF_stipe_center | 0.000613 | yes |
Casing | DIF_stipe_shell | 0.000613 | yes |
Casing | DIF_stipe_skin | 0.041603 | yes |
Casing | DIF_cap_skin | 0.000613 | yes |
Casing | DIF_cap_tissue | 0.703809 | no |
DIF_gill_tissue | YFB_stipe_center | 0.422501 | no |
DIF_gill_tissue | YFB_stipe_shell | 0.249200 | no |
DIF_gill_tissue | YFB_stipe_skin | 0.358145 | no |
DIF_gill_tissue | YFB_cap_skin | 0.006742 | yes |
DIF_gill_tissue | YFB_cap_tissue | 0.000613 | yes |
DIF_gill_tissue | YFB_gill_tissue | 0.000613 | yes |
DIF_gill_tissue | YFB_veil | 0.000613 | yes |
YFB_stipe_center | YFB_stipe_shell | 0.853643 | no |
YFB_stipe_center | YFB_stipe_skin | 0.946665 | no |
YFB_stipe_center | YFB_cap_skin | 0.006742 | yes |
YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
YFB_stipe_center | YFB_gill_tissue | 0.000613 | yes |
YFB_stipe_center | YFB_veil | 0.001625 | yes |
YFB_stipe_shell | YFB_stipe_skin | 0.921871 | no |
YFB_stipe_shell | YFB_cap_skin | 0.006742 | yes |
YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
YFB_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
YFB_stipe_shell | YFB_veil | 0.002084 | yes |
YFB_stipe_skin | YFB_cap_skin | 0.006742 | yes |
YFB_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
YFB_stipe_skin | YFB_gill_tissue | 0.000613 | yes |
YFB_stipe_skin | YFB_veil | 0.001625 | yes |
YFB_cap_skin | YFB_cap_tissue | 0.370347 | no |
YFB_cap_skin | YFB_gill_tissue | 0.006387 | yes |
YFB_cap_skin | YFB_veil | 0.006387 | yes |
YFB_cap_tissue | YFB_gill_tissue | 0.000613 | yes |
YFB_cap_tissue | YFB_veil | 0.000613 | yes |
YFB_gill_tissue | YFB_veil | 0.667984 | no |
Initials | DIF_gill_tissue | 0.000613 | yes |
Initials | YFB_stipe_center | 0.009446 | yes |
Initials | YFB_stipe_shell | 0.024698 | yes |
Initials | YFB_stipe_skin | 0.014668 | yes |
Initials | YFB_cap_skin | 0.006742 | yes |
Initials | YFB_cap_tissue | 0.000613 | yes |
Initials | YFB_gill_tissue | 0.067706 | no |
Initials | YFB_veil | 0.336508 | no |
Initials | Pileal_Stipeal_center | 0.000613 | yes |
Initials | Pileal_Stipeal_shell | 0.425607 | no |
Initials | DIF_stipe_center | 0.000613 | yes |
Initials | DIF_stipe_shell | 0.047584 | yes |
Initials | DIF_stipe_skin | 0.891989 | no |
Initials | DIF_cap_skin | 0.000613 | yes |
Initials | DIF_cap_tissue | 0.012880 | yes |
Pileal_Stipeal_center | DIF_gill_tissue | 0.879521 | no |
Pileal_Stipeal_center | YFB_stipe_center | 0.253894 | no |
Pileal_Stipeal_center | YFB_stipe_shell | 0.124266 | no |
Pileal_Stipeal_center | YFB_stipe_skin | 0.204470 | no |
Pileal_Stipeal_center | YFB_cap_skin | 0.006742 | yes |
Pileal_Stipeal_center | YFB_cap_tissue | 0.000613 | yes |
Pileal_Stipeal_center | YFB_gill_tissue | 0.000613 | yes |
Pileal_Stipeal_center | YFB_veil | 0.000613 | yes |
Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.002525 | yes |
Pileal_Stipeal_center | DIF_stipe_center | 0.000613 | yes |
Pileal_Stipeal_center | DIF_stipe_shell | 0.087927 | no |
Pileal_Stipeal_center | DIF_stipe_skin | 0.000613 | yes |
Pileal_Stipeal_center | DIF_cap_skin | 0.000613 | yes |
Pileal_Stipeal_center | DIF_cap_tissue | 0.000613 | yes |
Pileal_Stipeal_shell | DIF_gill_tissue | 0.009773 | yes |
Pileal_Stipeal_shell | YFB_stipe_center | 0.171663 | no |
Pileal_Stipeal_shell | YFB_stipe_shell | 0.342473 | no |
Pileal_Stipeal_shell | YFB_stipe_skin | 0.241805 | no |
Pileal_Stipeal_shell | YFB_cap_skin | 0.006742 | yes |
Pileal_Stipeal_shell | YFB_cap_tissue | 0.000613 | yes |
Pileal_Stipeal_shell | YFB_gill_tissue | 0.004548 | yes |
Pileal_Stipeal_shell | YFB_veil | 0.050706 | no |
Pileal_Stipeal_shell | DIF_stipe_center | 0.000613 | yes |
Pileal_Stipeal_shell | DIF_stipe_shell | 0.430760 | no |
Pileal_Stipeal_shell | DIF_stipe_skin | 0.613651 | no |
Pileal_Stipeal_shell | DIF_cap_skin | 0.000613 | yes |
Pileal_Stipeal_shell | DIF_cap_tissue | 0.001625 | yes |
DIF_stipe_center | DIF_gill_tissue | 0.000613 | yes |
DIF_stipe_center | YFB_stipe_center | 0.000613 | yes |
DIF_stipe_center | YFB_stipe_shell | 0.000613 | yes |
DIF_stipe_center | YFB_stipe_skin | 0.000613 | yes |
DIF_stipe_center | YFB_cap_skin | 0.006742 | yes |
DIF_stipe_center | YFB_cap_tissue | 0.000613 | yes |
DIF_stipe_center | YFB_gill_tissue | 0.000613 | yes |
DIF_stipe_center | YFB_veil | 0.000613 | yes |
DIF_stipe_center | DIF_stipe_shell | 0.000613 | yes |
DIF_stipe_center | DIF_stipe_skin | 0.000613 | yes |
DIF_stipe_center | DIF_cap_skin | 0.000613 | yes |
DIF_stipe_center | DIF_cap_tissue | 0.000613 | yes |
DIF_stipe_shell | DIF_gill_tissue | 0.189511 | no |
DIF_stipe_shell | YFB_stipe_center | 0.768767 | no |
DIF_stipe_shell | YFB_stipe_shell | 0.943484 | no |
DIF_stipe_shell | YFB_stipe_skin | 0.849889 | no |
DIF_stipe_shell | YFB_cap_skin | 0.006742 | yes |
DIF_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
DIF_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
DIF_stipe_shell | YFB_veil | 0.003765 | yes |
DIF_stipe_shell | DIF_stipe_skin | 0.107603 | no |
DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
DIF_stipe_shell | DIF_cap_tissue | 0.000613 | yes |
DIF_stipe_skin | DIF_gill_tissue | 0.000613 | yes |
DIF_stipe_skin | YFB_stipe_center | 0.028437 | yes |
DIF_stipe_skin | YFB_stipe_shell | 0.070862 | no |
DIF_stipe_skin | YFB_stipe_skin | 0.043555 | yes |
DIF_stipe_skin | YFB_cap_skin | 0.006742 | yes |
DIF_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
DIF_stipe_skin | YFB_gill_tissue | 0.040058 | yes |
DIF_stipe_skin | YFB_veil | 0.238109 | no |
DIF_stipe_skin | DIF_cap_skin | 0.000613 | yes |
DIF_stipe_skin | DIF_cap_tissue | 0.008121 | yes |
DIF_cap_skin | DIF_gill_tissue | 0.000613 | yes |
DIF_cap_skin | YFB_stipe_center | 0.000613 | yes |
DIF_cap_skin | YFB_stipe_shell | 0.000613 | yes |
DIF_cap_skin | YFB_stipe_skin | 0.000613 | yes |
DIF_cap_skin | YFB_cap_skin | 0.561375 | no |
DIF_cap_skin | YFB_cap_tissue | 0.857226 | no |
DIF_cap_skin | YFB_gill_tissue | 0.000613 | yes |
DIF_cap_skin | YFB_veil | 0.000613 | yes |
DIF_cap_skin | DIF_cap_tissue | 0.000613 | yes |
DIF_cap_tissue | DIF_gill_tissue | 0.000613 | yes |
DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
DIF_cap_tissue | YFB_stipe_shell | 0.000613 | yes |
DIF_cap_tissue | YFB_stipe_skin | 0.000613 | yes |
DIF_cap_tissue | YFB_cap_skin | 0.006742 | yes |
DIF_cap_tissue | YFB_cap_tissue | 0.000613 | yes |
DIF_cap_tissue | YFB_gill_tissue | 0.471837 | no |
DIF_cap_tissue | YFB_veil | 0.175423 | no |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|112920 MRSLTFFALIASVLAATVTAVPLENSNLPGRDVDLETSATPGAPGWKRSEQGPGAPGWKRSEQGPGAPGWKRKEQ GPGAPGWKRTEDTPA* |
Coding | >AgabiH97|112920 ATGCGTTCTTTGACTTTTTTTGCTCTGATTGCTTCCGTTCTTGCGGCCACGGTCACTGCTGTGCCTCTGGAGAAC TCGAATCTCCCCGGTCGTGATGTAGACTTGGAGACGTCAGCTACTCCTGGTGCCCCTGGTTGGAAGCGCAGTGAA CAGGGTCCAGGCGCTCCTGGGTGGAAGCGCAGTGAACAAGGTCCAGGCGCTCCGGGGTGGAAGCGTAAGGAACAG GGTCCTGGTGCTCCTGGTTGGAAGCGCACTGAGGACACTCCTGCCTAA |
Transcript | >AgabiH97|112920 ATGCGTTCTTTGACTTTTTTTGCTCTGATTGCTTCCGTTCTTGCGGCCACGGTCACTGCTGTGCCTCTGGAGAAC TCGAATCTCCCCGGTCGTGATGTAGACTTGGAGACGTCAGCTACTCCTGGTGCCCCTGGTTGGAAGCGCAGTGAA CAGGGTCCAGGCGCTCCTGGGTGGAAGCGCAGTGAACAAGGTCCAGGCGCTCCGGGGTGGAAGCGTAAGGAACAG GGTCCTGGTGCTCCTGGTTGGAAGCGCACTGAGGACACTCCTGCCTAA |
Gene | >AgabiH97|112920 ATGCGTTCTTTGACTTTTTTTGCTCTGATTGCTTCCGTTCTTGCGGCCACGGTCACTGCTGTGCCTCTGGTATGT TAGATCTTTGAATCCTTCTATTTTGCCCTTCGTTTACCCTACCCGTAGGAGAACTCGAATCTCCCCGGTCGTGAT GTAGACTTGGAGACGTCAGCTACTGTTGGTTTATTTTTCTCTCCGGCGCCTTATCTATTTAATCACATTCGTGCC CTCAGCCTGGTGCCCCTGGTTGGAAGCGCAGTGAACAGGGTCCAGGCGCTCCTGGGTGGAAGCGCAGTGAACAAG GTCCCGGTGCTCCAGGGTGGAAGCGCAAAGAACAAGGTCCAGGTGCTCCAGGGTGGAAACGCGAAGAACAAGGTC CAGGTGCTCCTGGATGGAAGCGCAAAGAGCAAGGTCCGGGTGCTCCTGGTTGGAAACGCAGTGAACAAGGTCCAG GCGCTCCGGGGTGGAAGCGTAAGGAACAGGGTCCTGGTGCTCCTGGTTGGAAGCGCACTGAGGACACTCCTGCCT AA |